TkA08G268700 | RubberDandelionOmics

Gene overview

TkA08G268700

Reference: TK1151 Chr: Chr08 Coordinates: 70041195-70043937 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2099 bp · TkA08G268700|TK1151|cDNA

CGCGAACGCCATAACTTCTCTTTCGCCGTTACTCCTCCATAGACAACTATTACTTCCTCCATCTACCTCTCTGTGAAATCCATTACTCCTCCTGTTACGCCATAACTCATCTCGACGCCTCTGCCCCCTCGCTTCTGTGAAATCAATTGCCTCTGCCATCGCCATCCCCTTAATCGGCATCTGTGAATATCGAATCCCTCTCCATTAACGCCATCTGAAATTCTAATTTGATGAAATCAATTCCGTTTCAAGCTTTTGAT...

CDS

Download CDS FASTA

1404 bp · TkA08G268700|TK1151|CDS

ATGTACCACCCGATGTCTGCCCCTCCGCAATCGAGACCAGGTGGTTCCTTCTCGATCTCCATAAATCAATGCTTCTCCTTCTTTGCCACGAACCCCACCGACGAATCAGAATACCGAATCAGTCGACGCCAAAAACCCCACCAACGTAGTTGGGAATACAAAAGGATGGCTGTGGAAGATAGAATACGCAACTTACCAGGGCACTTGACAGACTCAATCTTAGAGCGGCTTCCGATTAAAGAGGCTGTAAGAACAAGCAT...

Protein

Download Protein FASTA

467 aa · TkA08G268700|TK1151|PROTEIN

MYHPMSAPPQSRPGGSFSISINQCFSFFATNPTDESEYRISRRQKPHQRSWEYKRMAVEDRIRNLPGHLTDSILERLPIKEAVRTSILSRKWRYRWTTMRELVFYEQFSKKFAKTGAFGHNGFIRIINQAMFLHEGPLLKFHLHIPHISLDSFQEVDQWMLFLSRNGVTELILTNSIHRYQLPFHVFSCLELRKLELTNCLFKPPLEFKGFPNLEDLELTNINFGDNLCGCQISLPQLKTLSLYMCINVCKFSIKATNLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G268700`
TK1151 ID	TkA08G268700
OH-1004 ID	LXL04_033490
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 89.936 / OH-1004 89.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G268700

Location Chr08:70041195-70043937 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At3g44060`	Putative F-box protein At3g44060.	No verified direct reference in this release
`At5g22730`	FBD-associated F-box protein At5g22730.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At2g05300`	Putative F-box/FBD/LRR-repeat protein At2g05300.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT1G32375

ath:AT3G59200

ath:AT5G50270

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.806

Rank 1 · TkA08G268700 · TK1151

Cytoplasm0.237

Rank 2 · TkA08G268700 · TK1151

Endoplasmic reticulum0.040

Rank 3 · TkA08G268700 · TK1151

Cell membrane0.037

Rank 4 · TkA08G268700 · TK1151

Plastid0.027

Rank 5 · TkA08G268700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box63-100 aa

PF23622LRR_At1g61320_AtMIF1141-265 aa

PF24758LRR_At5g56370156-370 aa

PF12799LRR_4169-200 aa

PF12799LRR_4192-222 aa

PF12799LRR_4212-247 aa

PF23622LRR_At1g61320_AtMIF1332-372 aa

PF12799LRR_4336-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G268700	`PF00646`	F-box	63	100	9.1e-06	26.1
TkA08G268700	`PF23622`	LRR_At1g61320_AtMIF1	141	265	5e-08	33.4
TkA08G268700	`PF24758`	LRR_At5g56370	156	370	2.9e-11	44.2
TkA08G268700	`PF12799`	LRR_4	169	200	0.037	15.0
TkA08G268700	`PF12799`	LRR_4	192	222	0.037	15.0
TkA08G268700	`PF12799`	LRR_4	212	247	0.037	15.0
TkA08G268700	`PF23622`	LRR_At1g61320_AtMIF1	332	372	5e-08	33.4
TkA08G268700	`PF12799`	LRR_4	336	371	0.037	15.0
TkA08G268700	`PF08387`	FBD	359	368	2.5e-05	24.8
TkA08G268700	`PF08387`	FBD	389	432	2.5e-05	24.8
TkA08G268700	`PF23622`	LRR_At1g61320_AtMIF1	408	439	5e-08	33.4
TkA08G268700	`PF24758`	LRR_At5g56370	417	439	2.9e-11	44.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	33.800%	Swiss-Prot	Medium
`Q9LXQ6`	Arabidopsis thaliana	sp\|Q9LXQ6\|FB193_ARATH Putative F-box protein At3g44060	24.800%	Swiss-Prot	Low
`Q9FNI8`	Arabidopsis thaliana	sp\|Q9FNI8\|FBD32_ARATH FBD-associated F-box protein At5g22730	23.800%	Swiss-Prot	Low
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	23.400%	Swiss-Prot	Low
`Q9SJ32`	Arabidopsis thaliana	sp\|Q9SJ32\|FDL15_ARATH Putative F-box/FBD/LRR-repeat protein At2g05300	24.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card