TkA08G268260 | RubberDandelionOmics

Gene overview

TkA08G268260

Reference: TK1151 Chr: Chr08 Coordinates: 69908350-69910271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1468 bp · TkA08G268260|TK1151|cDNA

TTGACATTCTAACCCGGTATGCTCAGTAAACTACTTGGTCGCTCCGAGCGTATGTTCAGGGGATGATGGCGAAAGGGAAATATAAACGGAGGTCTGTAACTTGTGTTAAAGAAGATAGAATCAGTAACTTGACGTCCCACTTGATAGACTCAATCTTAGAGCGGCTCCCATTGGAAGAAGCTGTTAGGACAAGCACTTTATCAAAAAATTGGAGGTACAGATGGACCACAATGAAGGCAATCGTCTTTGATGAGGACTTC...

CDS

Download CDS FASTA

1209 bp · TkA08G268260|TK1151|CDS

ATGATGGCGAAAGGGAAATATAAACGGAGGTCTGTAACTTGTGTTAAAGAAGATAGAATCAGTAACTTGACGTCCCACTTGATAGACTCAATCTTAGAGCGGCTCCCATTGGAAGAAGCTGTTAGGACAAGCACTTTATCAAAAAATTGGAGGTACAGATGGACCACAATGAAGGCAATCGTCTTTGATGAGGACTTCACCAACAAGTTCACTAAAAACAGAGAGTTTGATTGTGACGGCTTTACAAGTACCATAAACCA...

Protein

Download Protein FASTA

402 aa · TkA08G268260|TK1151|PROTEIN

MMAKGKYKRRSVTCVKEDRISNLTSHLIDSILERLPLEEAVRTSTLSKNWRYRWTTMKAIVFDEDFTNKFTKNREFDCDGFTSTINQVLSKNVVKNIIEITENHPYEVPSNVFSCPGLTKLLLETCFFKPPLNFEGFFNLTELTLDRVLFGPSLYGTRINLPQLKKLCLSQCIKVSNFNVKTTKLHDLLVITCRDANFLQLLDNPYLKMVGISFRLIQNFDGIERLNLVSMLSNLPRVEDFLIEGNFLKFLSAEKFPKWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G268260`
TK1151 ID	TkA08G268260
OH-1004 ID	LXL04_033507
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.300
Protein coverage (%)	TK1151 99.254 / OH-1004 99.542 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G268260

Location Chr08:69908350-69910271 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033507 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT1G32375

ath:AT5G50270

ath:AT5G56370

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.765

Rank 1 · TkA08G268260 · TK1151

Cytoplasm0.312

Rank 2 · TkA08G268260 · TK1151

Endoplasmic reticulum0.042

Rank 3 · TkA08G268260 · TK1151

Cell membrane0.033

Rank 4 · TkA08G268260 · TK1151

Plastid0.023

Rank 5 · TkA08G268260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box20-57 aa

PF22080Dark_CARD66-103 aa

PF23622LRR_At1g61320_AtMIF184-209 aa

PF24758LRR_At5g56370104-301 aa

PF08387FBD288-301 aa

PF08387FBD329-365 aa

PF24758LRR_At5g56370337-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G268260	`PF00646`	F-box	20	57	2.1e-06	28.1
TkA08G268260	`PF22080`	Dark_CARD	66	103	0.065	14.5
TkA08G268260	`PF23622`	LRR_At1g61320_AtMIF1	84	209	0.00051	20.3
TkA08G268260	`PF24758`	LRR_At5g56370	104	301	1.3e-06	29.0
TkA08G268260	`PF08387`	FBD	288	301	3.6e-07	30.7
TkA08G268260	`PF08387`	FBD	329	365	3.6e-07	30.7
TkA08G268260	`PF24758`	LRR_At5g56370	337	366	1.3e-06	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	29.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card