TkA08G258630 | RubberDandelionOmics

Gene overview

TkA08G258630

Reference: TK1151 Chr: Chr08 Coordinates: 67437244-67440500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1843 bp · TkA08G258630|TK1151|cDNA

ATACCCTCGTGCCTACTCCTACTCCTCTTCATTTTCACACCCAAATAAACCCCTCCCCATTTCTCTTTTCACATACACATCTGTATATCCATCTGTCTTTATCTCTCCTTATACCTTACATTCATCTTTTTCCGTTTCCTCTTTCAGATTTTCATGAATTGATTTAATTGAATGTTGAACCGATCTTAGGGTTTTAGCATCTTCTAATTGGTTTACTGTTCTTCTTTGCTGATTTTGAAGTCTTAAGTTGCTTACAACTC...

CDS

Download CDS FASTA

1218 bp · TkA08G258630|TK1151|CDS

ATGGCAGCTGAACTTGTTACTGCAGCAACAAGTGAGAAACTAGCAGAAATGGATTGGACTAAAAGCATCGAAATTTGTGAATTAGTTGCACGTGATCATAGGCAAGCTAAAGATGTCATTAAAGCCATAAAAAAACGCCTAGCAAGCAAAAGCAAAGACACACAACTATATACCGTTATGTTGCTTGAGGTATTGATGAATAATATTGGAGAACCAATTCACACACAAGTGATCGACACAGGCTTGCTCCCTGTACTTGT...

Protein

Download Protein FASTA

405 aa · TkA08G258630|TK1151|PROTEIN

MAAELVTAATSEKLAEMDWTKSIEICELVARDHRQAKDVIKAIKKRLASKSKDTQLYTVMLLEVLMNNIGEPIHTQVIDTGLLPVLVKIVKKKSTSNLPVREKIFLLLDATQTSLGGASGRFPQYYTAYYDLVSAGVQFSQTPEVLPKNHSTSDSSKSNSSNGEVVTNGHDRSAPPSVPQTLPDSSIIQKAGSALEVLRDVLDAIDSRHPEQAKDEFTLDLVEQCSFHKQRVMHLAVTSRDEKTISQAIELNDQLQKALS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G258630`
TK1151 ID	TkA08G258630
OH-1004 ID	LXL04_033462
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G258630

Location Chr08:67437244-67440500 (+)

Description Similar to TOL5: TOM1-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63640`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At3g08790`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At1g21380`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At1g76970`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At4g32760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033462 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0035091 phosphatidylinositol binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT1G21380

ath:AT1G76970

ath:AT3G08790

ath:AT4G32760

ath:AT5G63640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.718

Rank 1 · TkA08G258630 · TK1151

Nucleus0.255

Rank 2 · TkA08G258630 · TK1151

Cell membrane0.127

Rank 3 · TkA08G258630 · TK1151

Golgi apparatus0.092

Rank 4 · TkA08G258630 · TK1151

Lysosome / Vacuole0.084

Rank 5 · TkA08G258630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00790VHS5-112 aa

PF04818CID12-104 aa

PF16730DnaGprimase_HBD49-107 aa

PF16730DnaGprimase_HBD185-262 aa

PF03127GAT195-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G258630	`PF00790`	VHS	5	112	2.4e-20	73.5
TkA08G258630	`PF04818`	CID	12	104	0.05	14.6
TkA08G258630	`PF16730`	DnaGprimase_HBD	49	107	0.068	13.8
TkA08G258630	`PF16730`	DnaGprimase_HBD	185	262	0.068	13.8
TkA08G258630	`PF03127`	GAT	195	268	8.6e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFQ0`	Arabidopsis thaliana	sp\|Q9FFQ0\|TOL5_ARATH TOM1-like protein 5	54.600%	Swiss-Prot	High
`Q9C9Y1`	Arabidopsis thaliana	sp\|Q9C9Y1\|TOL8_ARATH TOM1-like protein 8	37.600%	Swiss-Prot	Medium
`Q9LPL6`	Arabidopsis thaliana	sp\|Q9LPL6\|TOL3_ARATH TOM1-like protein 3	38.500%	Swiss-Prot	Medium
`Q6NQK0`	Arabidopsis thaliana	sp\|Q6NQK0\|TOL4_ARATH TOM1-like protein 4	37.600%	Swiss-Prot	Medium
`Q8L860`	Arabidopsis thaliana	sp\|Q8L860\|TOL9_ARATH TOM1-like protein 9	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card