TkA08G255850 | RubberDandelionOmics

Gene overview

TkA08G255850

Reference: TK1151 Chr: Chr08 Coordinates: 66717343-66718109 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · TkA08G255850|TK1151|cDNA

ATGATCGGAGAAGGGAAGGCGGTGTGTGTTACAGGCGCTTCGGGATACATAGCTTCATGGCTCGTTAAGTTCCTGCTTCAGCGCGGCTACACTGTCCACGCTACTGTGCGCTCCCTCGATGATCCAAAAAAGACACAACACCTAATTGCCTTCGATGGAGCTAACGAGAGGCTGTCTTTATTTGAAGCCAACTTAACTGAAGAAGGATCTTTCGATTCTGCAGTTAATGGTTGCGAATGTGTCTTTCATATGGCATCCCC...

CDS

Download CDS FASTA

540 bp · TkA08G255850|TK1151|CDS

ATGATCGGAGAAGGGAAGGCGGTGTGTGTTACAGGCGCTTCGGGATACATAGCTTCATGGCTCGTTAAGTTCCTGCTTCAGCGCGGCTACACTGTCCACGCTACTGTGCGCTCCCTCGATGATCCAAAAAAGACACAACACCTAATTGCCTTCGATGGAGCTAACGAGAGGCTGTCTTTATTTGAAGCCAACTTAACTGAAGAAGGATCTTTCGATTCTGCAGTTAATGGTTGCGAATGTGTCTTTCATATGGCATCCCC...

Protein

Download Protein FASTA

179 aa · TkA08G255850|TK1151|PROTEIN

MIGEGKAVCVTGASGYIASWLVKFLLQRGYTVHATVRSLDDPKKTQHLIAFDGANERLSLFEANLTEEGSFDSAVNGCECVFHMASPLIPPLSVSDPKSQYLDPAVNGTLNVLKSAAKVSSLKRVVLTSSMTAVLNGVKPREFGAVVDETWFSDPATCEQKKLWYPLSKTVAENAAVKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G255850`
TK1151 ID	TkA08G255850
OH-1004 ID	LXL04_033380
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G255850

Location Chr08:66717343-66718109 (+)

Description Similar to TKPR1: Tetraketide alpha-pyrone reductase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35420`	Involved in the biosynthesis of hydroxylated tetraketide compounds that serve as sporopollenin precursors (the main constituents of exine).	An anther-specific dihydroflavonol 4-reductase-like gene (DRL1) is essential for male fertility in Arabidopsis.2009 · DOI: 10.1111/j.1469-8137.2008.02692.x Analysis of TETRAKETIDE α-PYRONE REDUCTASE function in Arabidopsis thaliana reveals a previously unknown, but conserved, biochemical pathway in sporopollenin monomer biosynthesis.2010 · DOI: 10.1105/tpc.110.080036

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009555 pollen development Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0048316 seed development Biological Process

GO:0080110 sporopollenin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT4G35420

mtr:11427940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725

Rank 1 · TkA08G255850 · TK1151

Nucleus0.259

Rank 2 · TkA08G255850 · TK1151

Endoplasmic reticulum0.071

Rank 3 · TkA08G255850 · TK1151

Peroxisome0.062

Rank 4 · TkA08G255850 · TK1151

Mitochondrion0.061

Rank 5 · TkA08G255850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA6-86 aa

PF00106adh_short6-78 aa

PF01370Epimerase8-133 aa

PF02719Polysacc_synt_28-134 aa

PF08659KR9-137 aa

PF010733Beta_HSD10-175 aa

PF16363GDP_Man_Dehyd10-130 aa

PF07993NAD_binding_410-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G255850	`PF05368`	NmrA	6	86	4.1e-09	37.2
TkA08G255850	`PF00106`	adh_short	6	78	0.0044	17.2
TkA08G255850	`PF01370`	Epimerase	8	133	4.8e-15	56.3
TkA08G255850	`PF02719`	Polysacc_synt_2	8	134	0.0025	17.8
TkA08G255850	`PF08659`	KR	9	137	0.002	18.8
TkA08G255850	`PF01073`	3Beta_HSD	10	175	4e-15	56.3
TkA08G255850	`PF16363`	GDP_Man_Dehyd	10	130	3.9e-14	53.6
TkA08G255850	`PF07993`	NAD_binding_4	10	174	1.9e-10	41.1
TkA08G255850	`PF13460`	NAD_binding_10	12	149	8.2e-11	42.8
TkA08G255850	`PF00106`	adh_short	107	133	0.0044	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q500U8`	Arabidopsis thaliana	sp\|Q500U8\|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card