TkA08G251940 | RubberDandelionOmics

Gene overview

TkA08G251940

Reference: TK1151 Chr: Chr08 Coordinates: 65776269-65776874 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA08G251940|TK1151|cDNA

ATGCAATATGTCAACAATGGTACAAGAGAGCTTGACTGGCTCGCAATGCACAGGATTGCAATCGGTATTGCACATGGGATGGAGTATCTTCACACGAGCATTACCCCTCAAATAGCCCACCGAGACCTAAAACCTGCAAACATCCTCCTCGACCACAATATGGAGCCTAGCTACGGTGTGCTGTTGGAATTTTTGGTCATCGGAAAGCTTCCATCGGATGAGTTTTTTCAGGAGACGTCGGAAATGAGTATGGTGAGATG...

CDS

Download CDS FASTA

468 bp · TkA08G251940|TK1151|CDS

ATGCAATATGTCAACAATGGTACAAGAGAGCTTGACTGGCTCGCAATGCACAGGATTGCAATCGGTATTGCACATGGGATGGAGTATCTTCACACGAGCATTACCCCTCAAATAGCCCACCGAGACCTAAAACCTGCAAACATCCTCCTCGACCACAATATGGAGCCTAGCTACGGTGTGCTGTTGGAATTTTTGGTCATCGGAAAGCTTCCATCGGATGAGTTTTTTCAGGAGACGTCGGAAATGAGTATGGTGAGATG...

Protein

Download Protein FASTA

155 aa · TkA08G251940|TK1151|PROTEIN

MQYVNNGTRELDWLAMHRIAIGIAHGMEYLHTSITPQIAHRDLKPANILLDHNMEPSYGVLLEFLVIGKLPSDEFFQETSEMSMVRWMTMLVTSGNPENAINPKLTGKGYDAQMILLLKMACLCTRKNPQDSRLLVRIVGLCSRKSQWEYDLEDN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G251940`
TK1151 ID	TkA08G251940
OH-1004 ID	LXL04_033341
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.516 / OH-1004 78.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G251940

Location Chr08:65776269-65776874 (-)

Description Similar to SOBIR1: Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31880`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	Regulation of cell death and innate immunity by two receptor-like kinases in Arabidopsis.2009 · DOI: 10.1016/j.chom.2009.05.019 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140
`At1g17750`	Acts as a receptor for PEP defense peptides.	No verified direct reference in this release
`At1g73080`	Acts as a receptor for PEP defense peptides.	The cell surface leucine-rich repeat receptor for AtPep1, an endogenous peptide elicitor in Arabidopsis, is functional in transgenic tobacco cells.2006 · DOI: 10.1073/pnas.0603729103 BIK1 interacts with PEPRs to mediate ethylene-induced immunity.2013 · DOI: 10.1073/pnas.1215543110
`At1g66980`	Atypical receptor-like kinase involved in disease resistance.	Activation of plant immune responses by a gain-of-function mutation in an atypical receptor-like kinase.2010 · DOI: 10.1104/pp.110.158501
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033341 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045184 establishment of protein localization Biological Process

KEGG gene cross-reference

ath:AT1G08590

ath:AT1G17750

ath:AT1G78530

ath:AT2G31880

ath:AT4G20140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.404

Rank 1 · TkA08G251940 · TK1151

Cytoplasm0.360

Rank 2 · TkA08G251940 · TK1151

Nucleus0.219

Rank 3 · TkA08G251940 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA08G251940 · TK1151

Golgi apparatus0.047

Rank 5 · TkA08G251940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-54 aa

PF00069Pkinase16-53 aa

PF00069Pkinase57-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G251940	`PF07714`	PK_Tyr_Ser-Thr	3	54	5.9e-06	26.5
TkA08G251940	`PF00069`	Pkinase	16	53	1.6e-07	31.7
TkA08G251940	`PF00069`	Pkinase	57	89	1.6e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKB2`	Arabidopsis thaliana	sp\|Q9SKB2\|SBIR1_ARATH Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1	43.700%	Swiss-Prot	Medium
`Q9FZ59`	Arabidopsis thaliana	sp\|Q9FZ59\|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2	54.500%	Swiss-Prot	Low
`Q9SSL9`	Arabidopsis thaliana	sp\|Q9SSL9\|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1	53.100%	Swiss-Prot	Low
`D7SFH9`	Arabidopsis thaliana	sp\|D7SFH9\|LRL26_ARATH Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4	54.300%	Swiss-Prot	Low
`Q9M0G7`	Arabidopsis thaliana	sp\|Q9M0G7\|MIK1_ARATH MDIS1-interacting receptor like kinase 1	48.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card