TkA08G249570 | RubberDandelionOmics

Gene overview

TkA08G249570

Reference: TK1151 Chr: Chr08 Coordinates: 65169850-65174150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2210 bp · TkA08G249570|TK1151|cDNA

CCCAAAATTTCGGTTACTAAATACAGATACGGACGAAAGTTTATTCAATTATAATTCGAAATGCTGATCTTATTGAAGAAAGAAATCAAAATATATAAAATAAATATTGGATCCAGTTGGTCCTGCTTGACCAAAACTCAAACCTAGCGTGCAAAGTGGAAGCACCGGCATGCTACCATCACCACTGAGCATTGCTCCATCATATTCCATTTTTGAAACTTTTTCTATCAAATAAGCAAACTCTAATAACTCGTTAAACG...

CDS

Download CDS FASTA

1608 bp · TkA08G249570|TK1151|CDS

ATGGAGGGTATAGTCCTTTTATCCCTAACAATATTCATAGTGACGGTGATGAGTGCTTCAGCTAAAATACCCACTACCATTGATGGCCCATTTAAACCTGTAACCCGAAAATTCGACCCGTCTCTTCGTAGAGGCAGCGACGATCTTCCCATGAGTCATCCCAGATTAAAGAAGAATGTGACTTCAAATTTCCCAGAACAAATTGCTTTAGCACTTTCCTCCGCAAATTCCATGTGGGTATCATGGATCACTGGGGATGC...

Protein

Download Protein FASTA

535 aa · TkA08G249570|TK1151|PROTEIN

MEGIVLLSLTIFIVTVMSASAKIPTTIDGPFKPVTRKFDPSLRRGSDDLPMSHPRLKKNVTSNFPEQIALALSSANSMWVSWITGDAQIGKNVTPLDPSTVASEVWYGVKSGHYSKKRKGVSVIYNQLYPFKGLLNYTSGIIHHVKIDGLKPGSKYYYKCGDSSIPAMSEERVFETLPLPSPDAYPRRIGIVGDLGLTANTTTTIDHLIQNDPSLIVMVGDLSYANQYLTTGGDGASCFSCAFPDAPIRETYQPRWDGWG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G249570`
TK1151 ID	TkA08G249570
OH-1004 ID	LXL04_033308
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 99.813 / OH-1004 98.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G249570

Location Chr08:65169850-65174150 (-)

Description Similar to PAP23: Purple acid phosphatase 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13700`	Acid phosphatase activity with ATP, ADP, dATP, pyrophosphate, polyphosphate, phosphoserine and phosphothreonine.	Expression patterns of purple acid phosphatase genes in Arabidopsis organs and functional analysis of AtPAP23 predominantly transcribed in flower.2005 · DOI: 10.1007/s11103-005-0183-0
`At3g07130`	Acid phosphatase activity with p-nitrophenyl phosphate (pNPP), D-myoinositol 1-phosphate (Ins(1)P1), phytic acid and Myo- inositol hexakisphosphate.	An Arabidopsis purple acid phosphatase with phytase activity increases foliar ascorbate.2008 · DOI: 10.1104/pp.107.109934
`At2g32770`	Purple acid phosphatase 13.	No verified direct reference in this release
`At3g52780`	Probable purple acid phosphatase 20.	No verified direct reference in this release
`At3g52820`	Purple acid phosphatase 22.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033308 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009845 seed germination Biological Process

GO:0009846 pollen germination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0008707 inositol hexakisphosphate 4-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G32770

ath:AT3G07130

ath:AT3G52780

ath:AT3G52820

ath:AT4G13700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.279

Rank 1 · TkA08G249570 · TK1151

Cell membrane0.253

Rank 2 · TkA08G249570 · TK1151

Lysosome / Vacuole0.235

Rank 3 · TkA08G249570 · TK1151

Cytoplasm0.094

Rank 4 · TkA08G249570 · TK1151

Endoplasmic reticulum0.081

Rank 5 · TkA08G249570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656Pur_ac_phosph_N65-176 aa

PF16655PhoD_N139-171 aa

PF00149Metallophos188-401 aa

PF16655PhoD_N306-317 aa

PF14008Metallophos_C416-435 aa

PF14008Metallophos_C469-516 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G249570	`PF16656`	Pur_ac_phosph_N	65	176	2.5e-17	64.0
TkA08G249570	`PF16655`	PhoD_N	139	171	0.083	13.8
TkA08G249570	`PF00149`	Metallophos	188	401	4e-22	80.3
TkA08G249570	`PF16655`	PhoD_N	306	317	0.083	13.8
TkA08G249570	`PF14008`	Metallophos_C	416	435	2e-16	61.1
TkA08G249570	`PF14008`	Metallophos_C	469	516	2e-16	61.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6TPH1`	Arabidopsis thaliana	sp\|Q6TPH1\|PPA23_ARATH Purple acid phosphatase 23	75.500%	Swiss-Prot	High
`Q9SFU3`	Arabidopsis thaliana	sp\|Q9SFU3\|PPA15_ARATH Purple acid phosphatase 15	61.800%	Swiss-Prot	High
`O48840`	Arabidopsis thaliana	sp\|O48840\|PPA13_ARATH Purple acid phosphatase 13	51.500%	Swiss-Prot	High
`Q9LXI7`	Arabidopsis thaliana	sp\|Q9LXI7\|PPA20_ARATH Probable purple acid phosphatase 20	39.200%	Swiss-Prot	Medium
`Q8S340`	Arabidopsis thaliana	sp\|Q8S340\|PPA22_ARATH Purple acid phosphatase 22	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card