TkA08G248980 | RubberDandelionOmics

Gene overview

TkA08G248980

Reference: TK1151 Chr: Chr08 Coordinates: 65028634-65029980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA08G248980|TK1151|cDNA

ATGTATTACTATGAAGTTATTGGATTATATGAAAAATATGAAACAACGACTACTTCCCTTGATATTCCACATGAGGCATTAGTTGCTGAAGTTACCAAGGGGTTTAGCCATCGATTAGCCCCATTGAACATGTTTGTGAAAGAACTTAGTGACGGCGTGCAGCTTTCCAAAATTGAACATGAAGAAACTCAGGGATATGGTGGTAAGAAGAGAAAGAAAAACATCGATGGTGGGGAGAATTCGAAACCGAGAGATGTGGT...

CDS

Download CDS FASTA

465 bp · TkA08G248980|TK1151|CDS

ATGTATTACTATGAAGTTATTGGATTATATGAAAAATATGAAACAACGACTACTTCCCTTGATATTCCACATGAGGCATTAGTTGCTGAAGTTACCAAGGGGTTTAGCCATCGATTAGCCCCATTGAACATGTTTGTGAAAGAACTTAGTGACGGCGTGCAGCTTTCCAAAATTGAACATGAAGAAACTCAGGGATATGGTGGTAAGAAGAGAAAGAAAAACATCGATGGTGGGGAGAATTCGAAACCGAGAGATGTGGT...

Protein

Download Protein FASTA

154 aa · TkA08G248980|TK1151|PROTEIN

MYYYEVIGLYEKYETTTTSLDIPHEALVAEVTKGFSHRLAPLNMFVKELSDGVQLSKIEHEETQGYGGKKRKKNIDGGENSKPRDVVHVRPKRGEATDSHSLAERMRREKINKKLRRLQDRSDDGNVSDVGGKYPFKRSTQSSSHEVIAPAGVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G248980`
TK1151 ID	TkA08G248980
OH-1004 ID	LXL04_024958
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G248980

Location Chr08:65028634-65029980 (+)

Description Similar to BHLH75: Transcription factor bHLH75

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25330`	Transcription factor bHLH75.	No verified direct reference in this release
`At1g73830`	Positive regulator of brassinosteroid signaling.	No verified direct reference in this release
`At3g07340`	Transcription factor bHLH62.	No verified direct reference in this release
`At1g18400`	Positive regulator of brassinosteroid signaling.	No verified direct reference in this release
`At5g48560`	Transcription factor that binds DNA to G box 5'-CACGTG-3' and to E-box 5'-CANNTG-3' (By similarity).	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051511 negative regulation of unidimensional cell growth Biological Process

GO:0071368 cellular response to cytokinin stimulus Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:2000488 positive regulation of brassinosteroid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G25330

ath:AT3G07340

ath:AT5G48560

ath:AT5G50915

dosa:Os09g0510500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.918

Rank 1 · TkA08G248980 · TK1151

Cytoplasm0.144

Rank 2 · TkA08G248980 · TK1151

Cell membrane0.039

Rank 3 · TkA08G248980 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA08G248980 · TK1151

Mitochondrion0.013

Rank 5 · TkA08G248980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH49-59 aa

PF00010HLH99-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G248980	`PF00010`	HLH	49	59	0.039	14.5
TkA08G248980	`PF00010`	HLH	99	120	0.039	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A4D998`	Arabidopsis thaliana	sp\|A4D998\|BH075_ARATH Transcription factor bHLH75	71.700%	Swiss-Prot	Low
`Q8GWK7`	Arabidopsis thaliana	sp\|Q8GWK7\|BEE3_ARATH Transcription factor BEE 3	62.700%	Swiss-Prot	Low
`Q9SRT2`	Arabidopsis thaliana	sp\|Q9SRT2\|BH062_ARATH Transcription factor bHLH62	44.900%	Swiss-Prot	Low
`Q8GZ13`	Arabidopsis thaliana	sp\|Q8GZ13\|BEE1_ARATH Transcription factor BEE 1	75.700%	Swiss-Prot	Low
`Q9FJL4`	Arabidopsis thaliana	sp\|Q9FJL4\|BH078_ARATH Transcription factor bHLH78	65.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card