TkA08G247560 | RubberDandelionOmics

Gene overview

TkA08G247560

Reference: TK1151 Chr: Chr08 Coordinates: 64694064-64694423 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA08G247560|TK1151|cDNA

ATGGCGGATGTGTATAGCTTCGGTGTGGTGGTTCTTGAGGTGGTTACCGGCCAGATGGCGGTGGATTTTCGAAATGCCGATGTTTTGTTAGTGAGAAGGGTACATGAATTTGAGAGCCAAGAAAAGGATTATAAACAATTGGTGGATCCTAGGTTAGATGGAGAGTATGATCATGAAGAATTGGTGAGGTTGGTGAAGTTAGGCGTGGCTTGCACGTGGTCAAACCCCATGTTAAGACCAACCATGCGTCAGGTTGTTTC...

CDS

Download CDS FASTA

360 bp · TkA08G247560|TK1151|CDS

ATGGCGGATGTGTATAGCTTCGGTGTGGTGGTTCTTGAGGTGGTTACCGGCCAGATGGCGGTGGATTTTCGAAATGCCGATGTTTTGTTAGTGAGAAGGGTACATGAATTTGAGAGCCAAGAAAAGGATTATAAACAATTGGTGGATCCTAGGTTAGATGGAGAGTATGATCATGAAGAATTGGTGAGGTTGGTGAAGTTAGGCGTGGCTTGCACGTGGTCAAACCCCATGTTAAGACCAACCATGCGTCAGGTTGTTTC...

Protein

Download Protein FASTA

119 aa · TkA08G247560|TK1151|PROTEIN

MADVYSFGVVVLEVVTGQMAVDFRNADVLLVRRVHEFESQEKDYKQLVDPRLDGEYDHEELVRLVKLGVACTWSNPMLRPTMRQVVSILDGRDKCLMEVGQKENIEEWKERERISFVIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G247560`
TK1151 ID	TkA08G247560
OH-1004 ID	LXL04_033274
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 99.160 / OH-1004 24.738 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G247560

Location Chr08:64694064-64694423 (-)

Description Similar to LECRKS2: Receptor like protein kinase S.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32800`	Receptor like protein kinase S.2.	No verified direct reference in this release
`At5g10290`	Probable LRR receptor-like serine/threonine-protein kinase At5g10290.	No verified direct reference in this release
`At5g65240`	Probable LRR receptor-like serine/threonine-protein kinase At5g65240.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033274 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32800

ath:AT3G55550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.437

Rank 1 · TkA08G247560 · TK1151

Cytoplasm0.436

Rank 2 · TkA08G247560 · TK1151

Nucleus0.234

Rank 3 · TkA08G247560 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA08G247560 · TK1151

Golgi apparatus0.057

Rank 5 · TkA08G247560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-88 aa

PF00069Pkinase2-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G247560	`PF07714`	PK_Tyr_Ser-Thr	2	88	0.0013	18.8
TkA08G247560	`PF00069`	Pkinase	2	86	0.007	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48837`	Arabidopsis thaliana	sp\|O48837\|LRKS2_ARATH Receptor like protein kinase S.2	51.900%	Swiss-Prot	High
`C0LGT1`	Arabidopsis thaliana	sp\|C0LGT1\|Y5129_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g10290	39.600%	Swiss-Prot	Medium
`C0LGX1`	Arabidopsis thaliana	sp\|C0LGX1\|Y5524_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g65240	37.700%	Swiss-Prot	Medium
`C0LGE0`	Arabidopsis thaliana	sp\|C0LGE0\|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650	41.300%	Swiss-Prot	Medium
`Q6K4T4`	Oryza sativa subsp. japonica	sp\|Q6K4T4\|SERK4_ORYSJ LRR receptor kinase SERK2	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card