TkA08G240160 | RubberDandelionOmics

Gene overview

TkA08G240160

Reference: TK1151 Chr: Chr08 Coordinates: 62623861-62628516 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · TkA08G240160|TK1151|cDNA

ATGCTACTCTCGTGGGTTTGTGGCAAATATCACCTTTGCCCCAAGGGCCCTATTTATACTAGAAGTGATACCCATGTGTCACTATCAAGTTGTCACACAAGCCTATTGTTTGGTGCTAATGCTTTTGCTCATGAAAGTGGAATCCATCAGGACGGGGTCCTAAAGAACAAAAGGACATATGAAATCATGTCACCTAAAGATATTGGACTTCACAGATCTGATGAGACTGGACTTACACTTGGAAAACTTAGGGATGCTGG...

CDS

Download CDS FASTA

714 bp · TkA08G240160|TK1151|CDS

ATGCTACTCTCGTGGGTTTGTGGCAAATATCACCTTTGCCCCAAGGGCCCTATTTATACTAGAAGTGATACCCATGTGTCACTATCAAGTTGTCACACAAGCCTATTGTTTGGTGCTAATGCTTTTGCTCATGAAAGTGGAATCCATCAGGACGGGGTCCTAAAGAACAAAAGGACATATGAAATCATGTCACCTAAAGATATTGGACTTCACAGATCTGATGAGACTGGACTTACACTTGGAAAACTTAGGGATGCTGG...

Protein

Download Protein FASTA

237 aa · TkA08G240160|TK1151|PROTEIN

MLLSWVCGKYHLCPKGPIYTRSDTHVSLSSCHTSLLFGANAFAHESGIHQDGVLKNKRTYEIMSPKDIGLHRSDETGLTLGKLRDAGFHILITSYQLLVSDEKYFRRVKWQYMVLDEAQAIKSATSIENHAGHGGALNEHQLSRLPFMLRRVKKDLVSELTRKTEVTVHCKLSSMQQAFYQAIKNKISLVELFDSNRGQHNEKKFMNLMNLVIQLRKVCNHPELFERNEGTSSTSFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G240160`
TK1151 ID	TkA08G240160
OH-1004 ID	LXL04_000339
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.500
Protein coverage (%)	TK1151 64.557 / OH-1004 14.334 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G240160

Location Chr08:62623861-62628516 (-)

Description Similar to INO80: Chromatin-remodeling ATPase INO80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57300`	ATPase component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and DNA repair (By similarity).	The INO80 protein controls homologous recombination in Arabidopsis thaliana.2004 · DOI: 10.1016/j.molcel.2004.09.034 Epigenetic silencing of a multifunctional plant stress regulator.2019 · DOI: 10.7554/elife.47835

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010571 positive regulation of nuclear cell cycle DNA replication Biological Process

KEGG gene cross-reference

ath:AT3G57300

cim:CIMG_06054

hsa:54617

mmu:68142

uma:UMAG_00751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · TkA08G240160 · TK1151

Cytoplasm0.392

Rank 2 · TkA08G240160 · TK1151

Mitochondrion0.084

Rank 3 · TkA08G240160 · TK1151

Cell membrane0.039

Rank 4 · TkA08G240160 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA08G240160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22617HCS_D237-75 aa

PF22615IPMS_D242-56 aa

PF00270DEAD73-125 aa

PF00176SNF2-rel_dom84-127 aa

PF22615IPMS_D2125-135 aa

PF21934Yop-YscD_ppl_3rd135-154 aa

PF00176SNF2-rel_dom146-224 aa

PF21934Yop-YscD_ppl_3rd171-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G240160	`PF22617`	HCS_D2	37	75	1.3e-15	58.3
TkA08G240160	`PF22615`	IPMS_D2	42	56	0.24	12.5
TkA08G240160	`PF00270`	DEAD	73	125	0.13	12.7
TkA08G240160	`PF00176`	SNF2-rel_dom	84	127	1.1e-23	84.5
TkA08G240160	`PF22615`	IPMS_D2	125	135	0.24	12.5
TkA08G240160	`PF21934`	Yop-YscD_ppl_3rd	135	154	0.16	12.5
TkA08G240160	`PF00176`	SNF2-rel_dom	146	224	1.1e-23	84.5
TkA08G240160	`PF21934`	Yop-YscD_ppl_3rd	171	191	0.16	12.5
TkA08G240160	`PF05176`	ATP-synt_10	172	207	0.013	15.5
TkA08G240160	`PF00270`	DEAD	179	179	0.13	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXS6`	Arabidopsis thaliana	sp\|Q8RXS6\|INO80_ARATH Chromatin-remodeling ATPase INO80	62.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card