TkA08G239760 | RubberDandelionOmics

Gene overview

TkA08G239760

Reference: TK1151 Chr: Chr08 Coordinates: 62468376-62471081 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

357 bp · TkA08G239760|TK1151|CDS

ATGGCTGCGAAGATCCTTGCAAATTTGATTGTTATGGGGTCTGGAATCTTGATTAGGGGAATGGTTCAAGCATATCGTCAGGCCCTCCAAAATGCATCAAAATCAGGTGTAGCTCAAGAAACAATACAAAATGCTGTGCGAAGAGGCAGCAAAGCCATGACTGAACAAGAAGCCAGGCAAATTCTTGGTGTCAATGAAACCTCATCATGGGAAGAAATTGCACAGAAATACGACAATTTATTTGAAAGAAACGCAAAAAA...

Protein

Download Protein FASTA

118 aa · TkA08G239760|TK1151|PROTEIN

MAAKILANLIVMGSGILIRGMVQAYRQALQNASKSGVAQETIQNAVRRGSKAMTEQEARQILGVNETSSWEEIAQKYDNLFERNAKNGSFYLQSKVHRAKECLETVYQPKNQPDENGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G239760`
TK1151 ID	TkA08G239760
OH-1004 ID	LXL04_033186
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G239760

Location Chr08:62468376-62471081 (+)

Description Similar to PAM16L2: Mitochondrial import inner membrane translocase subunit PAM16 like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59280`	Regulates ATP-dependent protein translocation into the mitochondrial matrix (By similarity).	An Arabidopsis mutant resistant to thaxtomin A, a cellulose synthesis inhibitor from Streptomyces species.2003 · DOI: 10.1105/tpc.013342 Enhanced resistance to the cellulose biosynthetic inhibitors, thaxtomin A and isoxaben in Arabidopsis thaliana mutants, also provides specific co-resistance to the auxin transport inhibitor, 1-NPA.2013 · DOI: 10.1186/1471-2229-13-76 Mitochondrial AtPAM16 is required for plant survival and the negative regulation of plant immunity.2013 · DOI: 10.1038/ncomms3558
`At5g61880`	Regulates ATP-dependent protein translocation into the mitochondrial matrix.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033186 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902289 negative regulation of defense response to oomycetes Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:2000378 negative regulation of reactive oxygen species metabolic process Biological Process

GO:0001405 PAM complex, Tim23 associated import motor Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G59280

ath:AT5G61880

dme:Dmel_CG5268

ncr:NCU05515

spo:2541152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.946

Rank 1 · TkA08G239760 · TK1151

Nucleus0.072

Rank 2 · TkA08G239760 · TK1151

Cytoplasm0.065

Rank 3 · TkA08G239760 · TK1151

Cell membrane0.030

Rank 4 · TkA08G239760 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA08G239760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03656Pam161-112 aa

PF10023Aminopep19-111 aa

PF15242FAM5321-79 aa

PF19936DUF639924-85 aa

PF26361MIB_arm25-90 aa

PF20772TACO1_YebC_N26-51 aa

PF18013Phage_lysozyme226-88 aa

PF00226DnaJ38-48 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G239760	`PF03656`	Pam16	1	112	3.1e-20	73.2
TkA08G239760	`PF10023`	Aminopep	19	111	0.0035	17.4
TkA08G239760	`PF15242`	FAM53	21	79	0.21	12.1
TkA08G239760	`PF19936`	DUF6399	24	85	0.026	15.2
TkA08G239760	`PF26361`	MIB_arm	25	90	0.0067	17.6
TkA08G239760	`PF20772`	TACO1_YebC_N	26	51	0.015	16.4
TkA08G239760	`PF18013`	Phage_lysozyme2	26	88	0.026	15.5
TkA08G239760	`PF00226`	DnaJ	38	48	0.18	12.7
TkA08G239760	`PF30912`	TIM141_C	51	105	1.3e-06	29.0
TkA08G239760	`PF10384`	Scm3	58	83	0.26	11.7
TkA08G239760	`PF00226`	DnaJ	60	81	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VV9`	Arabidopsis thaliana	sp\|Q93VV9\|TM16B_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 2	77.600%	Swiss-Prot	High
`Q93W66`	Arabidopsis thaliana	sp\|Q93W66\|TM16A_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 1	70.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card