TkA08G238230 | RubberDandelionOmics

Gene overview

TkA08G238230

Reference: TK1151 Chr: Chr08 Coordinates: 62024497-62029154 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3360 bp · TkA08G238230|TK1151|cDNA

ATGAAGACCAAGATCAGTACAATCCAAGCTTCGTTATACAAGCAGGAGAAAGACGCTGATGATTTCCGCATTCTCATGTTGACCTGGATGCAGAAAATAGAGAAAGTCGTCGGCCGCCCTAGTGGTGAAGACTCTGGTTCCGGGGTTTTTGAGCCCTCGTTTACTCCTCCTCCCACATCCGGTAGTCCCACTCCAATTACAATCCCTCCTGTACCTCCTGTATCTCCTGGTGGGGCTCCACCTTCAGGGGGTTTCCATTG...

CDS

Download CDS FASTA

3360 bp · TkA08G238230|TK1151|CDS

ATGAAGACCAAGATCAGTACAATCCAAGCTTCGTTATACAAGCAGGAGAAAGACGCTGATGATTTCCGCATTCTCATGTTGACCTGGATGCAGAAAATAGAGAAAGTCGTCGGCCGCCCTAGTGGTGAAGACTCTGGTTCCGGGGTTTTTGAGCCCTCGTTTACTCCTCCTCCCACATCCGGTAGTCCCACTCCAATTACAATCCCTCCTGTACCTCCTGTATCTCCTGGTGGGGCTCCACCTTCAGGGGGTTTCCATTG...

Protein

Download Protein FASTA

1119 aa · TkA08G238230|TK1151|PROTEIN

MKTKISTIQASLYKQEKDADDFRILMLTWMQKIEKVVGRPSGEDSGSGVFEPSFTPPPTSGSPTPITIPPVPPVSPGGAPPSGGFHCQLRRGGGVPKPNYSRADSIRPNFSPRTISNPPSDQSHIRDRGTRSLSRTEWEDRRKKGLCFRCGQQFGPAHKCPEGKLRILFLGDDEEEGYDVVLHSLEDMPASIEDELPMGSCSVLERFGSHTEVSSGVGVGRCEFIISALVFDAGHLDLVLGMEWLKTLGEVTHNWDQSWM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G238230`
TK1151 ID	TkA08G238230
OH-1004 ID	LXL04_034197
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G238230`
Location	Chr08:62024497-62029154 (+)
Description	Similar to Tf2-9: Transposon Tf2-9 polyprotein (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034197` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	spo:2542672 spo:2542797 spo:2543673 spo:3361218 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · TkA08G238230 · TK1151

Nucleus0.451

Rank 2 · TkA08G238230 · TK1151

Mitochondrion0.071

Rank 3 · TkA08G238230 · TK1151

Peroxisome0.038

Rank 4 · TkA08G238230 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA08G238230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08284RVP_2217-247 aa

PF30863PRO_PEG10-RTL1225-263 aa

PF00078RVT_1369-529 aa

PF00385Chromo437-447 aa

PF17919RT_RNaseH_2591-685 aa

PF17917RT_RNaseH616-715 aa

PF24626SH3_Tf2-1941-1005 aa

PF31073DUF8803958-1004 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G238230	`PF08284`	RVP_2	217	247	0.11	13.0
TkA08G238230	`PF30863`	PRO_PEG10-RTL1	225	263	0.068	14.3
TkA08G238230	`PF00078`	RVT_1	369	529	2.3e-38	132.8
TkA08G238230	`PF00385`	Chromo	437	447	3.6e-05	24.3
TkA08G238230	`PF17919`	RT_RNaseH_2	591	685	1.2e-28	99.8
TkA08G238230	`PF17917`	RT_RNaseH	616	715	3.7e-25	88.8
TkA08G238230	`PF24626`	SH3_Tf2-1	941	1005	2.6e-22	79.4
TkA08G238230	`PF31073`	DUF8803	958	1004	0.052	14.1
TkA08G238230	`PF22938`	Integrase_p58_C	970	1004	1.6e-05	25.6
TkA08G238230	`PF17919`	RT_RNaseH_2	1003	1030	1.2e-28	99.8
TkA08G238230	`PF00385`	Chromo	1030	1073	3.6e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card