RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G237430
Reference: TK1151 Chr: Chr08 Coordinates: 61851165-61854433 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2751 bp · TkA08G237430|TK1151|cDNA

ATGCAGCGTTTTATGGGGAGTAATGTGGGTGAGTACATTGTTTTCGGTGATTTCAACGCAGTAAGGAAGGCTGGGGAGCGATGGGGCTGCGAGTTTTCCAGCAGAGAAGCTACGGATTTTAATGCGTTTATAATTGATACGGGTCTTACAGAGGTGGATATGGGTGGCTTTGCGTTTACCAGAACTAGCCGTGGAGGAGATAAAATGAGCAAGTTAGACAGGTTTTTGATTACAGATGGAGTGGGGATAGCATATCCGGA...

CDS

Download CDS FASTA

2751 bp · TkA08G237430|TK1151|CDS

ATGCAGCGTTTTATGGGGAGTAATGTGGGTGAGTACATTGTTTTCGGTGATTTCAACGCAGTAAGGAAGGCTGGGGAGCGATGGGGCTGCGAGTTTTCCAGCAGAGAAGCTACGGATTTTAATGCGTTTATAATTGATACGGGTCTTACAGAGGTGGATATGGGTGGCTTTGCGTTTACCAGAACTAGCCGTGGAGGAGATAAAATGAGCAAGTTAGACAGGTTTTTGATTACAGATGGAGTGGGGATAGCATATCCGGA...

Protein

Download Protein FASTA

916 aa · TkA08G237430|TK1151|PROTEIN

MQRFMGSNVGEYIVFGDFNAVRKAGERWGCEFSSREATDFNAFIIDTGLTEVDMGGFAFTRTSRGGDKMSKLDRFLITDGVGIAYPELSAMALDCVISDHRPICLKEDVKDYGPKHFRFLNSWLQEESFEQVVRNSWEKVEESGRRGAAIRLKNKLKTLKEDIKAWWKKTNEGREKEKKQIDANLKEIEKKIDLGVASQEELEARLKLREMVFKMEKKMRQMAIKGVKKEGEWVVDPVLVKNVFIEHYKEKFKASPNLRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G237430
TK1151 IDTkA08G237430
OH-1004 IDLXL04_006431
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)43.700
Protein coverage (%)TK1151 98.035 / OH-1004 47.337
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G237430
LocationChr08:61851165-61854433 (+)
DescriptionSimilar to LINE-1 reverse transcriptase homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006431 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006310 DNA recombination Biological Process
GO:0032197 retrotransposition Biological Process
GO:0090304 nucleic acid metabolic process Biological Process
GO:0003676 nucleic acid binding Molecular Function
GO:0003723 RNA binding Molecular Function
GO:0003824 catalytic activity Molecular Function
GO:0003964 RNA-directed DNA polymerase activity Molecular Function
GO:0004519 endonuclease activity Molecular Function
GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function
GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function
GO:0016787 hydrolase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619
Rank 1 · TkA08G237430 · TK1151
Nucleus0.306
Rank 2 · TkA08G237430 · TK1151
Cell membrane0.118
Rank 3 · TkA08G237430 · TK1151
Golgi apparatus0.039
Rank 4 · TkA08G237430 · TK1151
Endoplasmic reticulum0.038
Rank 5 · TkA08G237430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14529Exo_endo_phos_211-104 aa
PF03372Exo_endo_phos12-100 aa
PF07195FliD_C125-222 aa
PF09304Cortex-I_coil147-208 aa
PF16454PI3K_P85_iSH2156-220 aa
PF00078RVT_1355-407 aa
PF00078RVT_1428-511 aa
PF16454PI3K_P85_iSH2533-553 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G237430PF14529Exo_endo_phos_2111040.0003621.1
TkA08G237430PF03372Exo_endo_phos121000.0913.2
TkA08G237430PF07195FliD_C1252220.89.8
TkA08G237430PF09304Cortex-I_coil1472080.6411.0
TkA08G237430PF16454PI3K_P85_iSH21562200.969.7
TkA08G237430PF00078RVT_13554072.1e-1041.5
TkA08G237430PF00078RVT_14285112.1e-1041.5
TkA08G237430PF16454PI3K_P85_iSH25335530.969.7
TkA08G237430PF13966zf-RVT7468155.2e-1453.4
TkA08G237430PF13966zf-RVT8578705.2e-1453.4
TkA08G237430PF13966zf-RVT8898975.2e-1453.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser