TkA08G236810 | RubberDandelionOmics

Gene overview

TkA08G236810

Reference: TK1151 Chr: Chr08 Coordinates: 61684546-61687789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2455 bp · TkA08G236810|TK1151|cDNA

TTTACAACAGCCTCTTGATGGTGGTGGTATAATACATTTCTTGCTATTAAAAGAAAGATAATAATGAAACCACTATTATCATTGATAAAACTGATCGATGTACCTTTTTCTGTGTGACATACTGACATTAATGAATTTAAAGGCTGACAAAAGTCATTTATATATTATGCCAAGTGTAGAGCCAGACGTGTTGGTGAATGGGTTAATTTTGGCCCAATCATCTCTTCCTCTTGATTCAAAATTTCAAATAGACAAAGCCA...

CDS

Download CDS FASTA

1794 bp · TkA08G236810|TK1151|CDS

ATGGATCCAGGACGAATGAACATGAGAGTTGGTTCATCAGGTTCAACACCATCAGAAGAATCAGCTCTGGATTTGGAGAAGACGTGTTACAGCCACTCAAATCCCCCTTCATTCAACCCACCAACTCTCCAACAGTACGCATCAGGTGGCCAACACTCAGAGAGCAACGCTGCCTACTTTTCATGGCCTACCTCCAGCCGACTAAGTGATGCTGCTGAAGAAAGAACAAACTATTTTGTTAACCTACAAAAGGGCGTTTT...

Protein

Download Protein FASTA

597 aa · TkA08G236810|TK1151|PROTEIN

MDPGRMNMRVGSSGSTPSEESALDLEKTCYSHSNPPSFNPPTLQQYASGGQHSESNAAYFSWPTSSRLSDAAEERTNYFVNLQKGVLPESIGRLPKGHQATSLLELMTIRASHSKILRCYSLGTAIGFRIRRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTILEGPGSVWCDVDVVEFSYFGAPEPSSKEQLYTDIVDDLRGSGSCIGSGSQVASQETYGTLGAIVRSQTGNRQVGFLTNRHVAVNLDYPNQKMFHPLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G236810`
TK1151 ID	TkA08G236810
OH-1004 ID	LXL04_033167
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G236810

Location Chr08:61684546-61687789 (+)

Description Similar to NAL1: Protein NARROW LEAF 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0615000`	Involved in the regulation of lateral leaf growth.	Mutation of the rice Narrow leaf1 gene, which encodes a novel protein, affects vein patterning and polar auxin transport.2008 · DOI: 10.1104/pp.108.118778 Fine mapping of a major QTL for flag leaf width in rice, qFLW4, which might be caused by alternative splicing of NAL1.2012 · DOI: 10.1007/s00299-011-1207-7 A natural variant of NAL1, selected in high-yield rice breeding programs, pleiotropically increases photosynthesis rate.2013 · DOI: 10.1038/srep02149 NAL1 allele from a rice landrace greatly increases yield in modern indica cultivars.2013 · DOI: 10.1073/pnas.1310790110 LSCHL4 from Japonica Cultivar, which is allelic to NAL1, increases yield of indica super rice 93-11.2014 · DOI: 10.1093/mp/ssu055

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0080006 internode patterning Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

dosa:Os04g0615000

osa:4336986

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA08G236810 · TK1151

Nucleus0.363

Rank 2 · TkA08G236810 · TK1151

Cell membrane0.127

Rank 3 · TkA08G236810 · TK1151

Mitochondrion0.095

Rank 4 · TkA08G236810 · TK1151

Endoplasmic reticulum0.088

Rank 5 · TkA08G236810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25608NAL1_N99-177 aa

PF25819Nal1_C190-457 aa

PF08192Peptidase_S64329-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G236810	`PF25608`	NAL1_N	99	177	1.6e-42	143.8
TkA08G236810	`PF25819`	Nal1_C	190	457	1.3e-158	526.9
TkA08G236810	`PF08192`	Peptidase_S64	329	405	0.00016	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B4XT64`	Oryza sativa subsp. japonica	sp\|B4XT64\|NAL1_ORYSJ Protein NARROW LEAF 1	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card