TkA08G235190 | RubberDandelionOmics

Gene overview

TkA08G235190

Reference: TK1151 Chr: Chr08 Coordinates: 61327348-61327881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · TkA08G235190|TK1151|cDNA

ATGTTCGAACCGATCGATGAGAAGCGACTTGGGCACTACTGGACGGGTCTTAGAACAAACATGATAGATATGGAAGATAGTAGTAGAACTCCTATTATCGAAATCATAGGATTCATGTACGAGTCGAGAAAATTCATGGAGAATCCATGGACTGGATTTGGTTATGAAATGAAGTTTATGAAGAATATCGAGGTGAATAAACATGGAAAGAAGGATTGGTATGATGGGAAAAGAGGACATGATGATGATCTTTATGCTTG...

CDS

Download CDS FASTA

369 bp · TkA08G235190|TK1151|CDS

ATGTTCGAACCGATCGATGAGAAGCGACTTGGGCACTACTGGACGGGTCTTAGAACAAACATGATAGATATGGAAGATAGTAGTAGAACTCCTATTATCGAAATCATAGGATTCATGTACGAGTCGAGAAAATTCATGGAGAATCCATGGACTGGATTTGGTTATGAAATGAAGTTTATGAAGAATATCGAGGTGAATAAACATGGAAAGAAGGATTGGTATGATGGGAAAAGAGGACATGATGATGATCTTTATGCTTG...

Protein

Download Protein FASTA

122 aa · TkA08G235190|TK1151|PROTEIN

MFEPIDEKRLGHYWTGLRTNMIDMEDSSRTPIIEIIGFMYESRKFMENPWTGFGYEMKFMKNIEVNKHGKKDWYDGKRGHDDDLYAWIARNEDYNCNGLVGDYLRKPGDLKTVRGKNKKKMK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G235190`
TK1151 ID	TkA08G235190
OH-1004 ID	LXL04_017817
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.300
Protein coverage (%)	TK1151 56.557 / OH-1004 10.918 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G235190

Location Chr08:61327348-61327881 (+)

Description Similar to IDN2: Protein INVOLVED IN DE NOVO 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48670`	Forms a complex with FDM1/IDNL1 and FDM2/IDNL2 that is required for RNA-directed DNA methylation (RdDM) and that functions at a downstream step of the RdDM pathway and downstream of small interfering RNA (siRNA) formation.	IDN1 and IDN2 are required for de novo DNA methylation in Arabidopsis thaliana.2009 · DOI: 10.1038/nsmb.1690 An SGS3-like protein functions in RNA-directed DNA methylation and transcriptional gene silencing in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04130.x IDN2 and its paralogs form a complex required for RNA-directed DNA methylation.2012 · DOI: 10.1371/journal.pgen.1002693 INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis.2012 · DOI: 10.1073/pnas.1206638109 IDN2 has a role downstream of siRNA formation in RNA-directed DNA methylation.2012 · DOI: 10.4161/epi.21237 A SWI/SNF chromatin-remodeling complex acts in noncoding RNA-mediated transcriptional silencing.2013 · DOI: 10.1016/j.molcel.2012.11.011 RNA-directed DNA methylation requires stepwise binding of silencing factors to long non-coding RNA.2014 · DOI: 10.1111/tpj.12563 Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1006026
`At3g12550`	Acts in association with FDM4 and FDM5 for RNA-directed DNA methylation (RdDM).	A subgroup of SGS3-like proteins act redundantly in RNA-directed DNA methylation.2012 · DOI: 10.1093/nar/gks034

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017817 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010569 regulation of double-strand break repair via homologous recombination Biological Process

GO:0032259 methylation Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003725 double-stranded RNA binding Molecular Function

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G13790

ath:AT1G15910

ath:AT3G12550

ath:AT3G48670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.332

Rank 1 · TkA08G235190 · TK1151

Nucleus0.217

Rank 2 · TkA08G235190 · TK1151

Cytoplasm0.208

Rank 3 · TkA08G235190 · TK1151

Mitochondrion0.105

Rank 4 · TkA08G235190 · TK1151

Plastid0.063

Rank 5 · TkA08G235190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03468XS47-95 aa

PF17206SeqA_N60-66 aa

PF17206SeqA_N81-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G235190	`PF03468`	XS	47	95	2.4e-10	41.5
TkA08G235190	`PF17206`	SeqA_N	60	66	0.45	10.6
TkA08G235190	`PF17206`	SeqA_N	81	91	0.45	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ79`	Arabidopsis thaliana	sp\|Q8VZ79\|IDN2_ARATH Protein INVOLVED IN DE NOVO 2	50.000%	Swiss-Prot	Medium
`Q9LHB1`	Arabidopsis thaliana	sp\|Q9LHB1\|FDM3_ARATH Factor of DNA methylation 3	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card