TkA08G234110 | RubberDandelionOmics

Gene overview

TkA08G234110

Reference: TK1151 Chr: Chr08 Coordinates: 61028493-61030148 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1225 bp · TkA08G234110|TK1151|cDNA

TTATAATTAAAAATGTAAAATAATTGGTTACAAGCCAACATTGGGACACTCTGTACGCAAGAAAATGACAACACATAACAACCATAAAACTCGGAGACATGAAAATGAGTTCCCCAAATCCTTAGCTGTACACCCGTCCCCCGTCTATGATTGAACCCCAATTTAATTTTGATCCCAAAAGCTCTACTGTTTCATTGGGAGAACTGATTAATTTCGGGAGTTCCGGATTACCGAAATCTTTGACTTTCTGGCCATCATCA...

CDS

Download CDS FASTA

651 bp · TkA08G234110|TK1151|CDS

ATGGGTCCCGGTGGTAACATCTTCCAAGACGTTACTGAATCGCGAGCTGATTATAATCTTAAATCTGCAAACATAGAAGGACGAAGCTGCCTGAGATTATGCGGATCCGCCGGTGGACGGCAGGGACTGGCTTCAAACAGCGCAGTCCATGAACTACTCGAGTGTCCCGTATGTCTTAACATAATGCACCCCCCAATTCATCAATGTCCAAATGGCCACACGATATGTGTGGTATGCAAATCGAAAGTACAAAACAGCTG...

Protein

Download Protein FASTA

216 aa · TkA08G234110|TK1151|PROTEIN

MGPGGNIFQDVTESRADYNLKSANIEGRSCLRLCGSAGGRQGLASNSAVHELLECPVCLNIMHPPIHQCPNGHTICVVCKSKVQNSCPICRQELGNIRCLALEKVAESIELPCKYHYLGCHDIFPYHSRIKHEENCKYRGYNCPYAGTECHVTGDIPFLVAHLKSDHNVDMHDGSTFNHRYVKPNPHEIENATWMLTVPSLSLSHTHTHTYTYSLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G234110`
TK1151 ID	TkA08G234110
OH-1004 ID	LXL04_033137
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.300
Protein coverage (%)	TK1151 91.667 / OH-1004 19.340 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G234110

Location Chr08:61028493-61030148 (+)

Description Similar to SINAT2: E3 ubiquitin-protein ligase SINAT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58040`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis.2017 · DOI: 10.1105/tpc.17.00056 SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267
`At2g41980`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis.2017 · DOI: 10.1105/tpc.17.00056 SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267 SINAT E3 ligases regulate the stability of the ESCRT component FREE1 in response to iron deficiency in plants.2020 · DOI: 10.1111/jipb.13005
`At3g61790`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267
`At4g27880`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267
`At5g53360`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT5 promotes ubiquitin-related degradation of NAC1 to attenuate auxin signals.2002 · DOI: 10.1038/nature00998 SINAT E3 ligases regulate the stability of the ESCRT component FREE1 in response to iron deficiency in plants.2020 · DOI: 10.1111/jipb.13005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:2000785 regulation of autophagosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005776 autophagosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G41980

ath:AT3G58040

ath:AT3G61790

ath:AT4G27880

ath:AT5G53360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547

Rank 1 · TkA08G234110 · TK1151

Nucleus0.431

Rank 2 · TkA08G234110 · TK1151

Mitochondrion0.086

Rank 3 · TkA08G234110 · TK1151

Cell membrane0.076

Rank 4 · TkA08G234110 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA08G234110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16866PHD_432-90 aa

PF21361Sina_ZnF49-62 aa

PF15750UBZ_FAAP2052-64 aa

PF14447Prok-RING_454-59 aa

PF13923zf-C3HC4_254-90 aa

PF21362Sina_RING55-90 aa

PF13445zf-RING_UBOX55-79 aa

PF00097zf-C3HC455-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G234110	`PF16866`	PHD_4	32	90	0.014	16.0
TkA08G234110	`PF21361`	Sina_ZnF	49	62	2.4e-28	99.1
TkA08G234110	`PF15750`	UBZ_FAAP20	52	64	5.6	7.6
TkA08G234110	`PF14447`	Prok-RING_4	54	59	0.0085	16.7
TkA08G234110	`PF13923`	zf-C3HC4_2	54	90	0.26	11.8
TkA08G234110	`PF21362`	Sina_RING	55	90	1e-12	48.7
TkA08G234110	`PF13445`	zf-RING_UBOX	55	79	0.016	15.9
TkA08G234110	`PF00097`	zf-C3HC4	55	90	0.42	11.2
TkA08G234110	`PF14447`	Prok-RING_4	65	94	0.0085	16.7
TkA08G234110	`PF16866`	PHD_4	76	87	0.014	16.0
TkA08G234110	`PF15750`	UBZ_FAAP20	85	93	5.6	7.6
TkA08G234110	`PF13445`	zf-RING_UBOX	87	96	0.016	15.9
TkA08G234110	`PF00097`	zf-C3HC4	87	98	0.42	11.2
TkA08G234110	`PF21361`	Sina_ZnF	104	179	2.4e-28	99.1
TkA08G234110	`PF21362`	Sina_RING	135	144	1e-12	48.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2P4`	Arabidopsis thaliana	sp\|Q9M2P4\|SINA2_ARATH E3 ubiquitin-protein ligase SINAT2	66.500%	Swiss-Prot	High
`P93748`	Arabidopsis thaliana	sp\|P93748\|SINA1_ARATH Putative E3 ubiquitin-protein ligase SINAT1	64.700%	Swiss-Prot	High
`Q84JL3`	Arabidopsis thaliana	sp\|Q84JL3\|SINA3_ARATH E3 ubiquitin-protein ligase SINAT3	72.400%	Swiss-Prot	High
`Q9STN8`	Arabidopsis thaliana	sp\|Q9STN8\|SINA4_ARATH E3 ubiquitin-protein ligase SINAT4	59.500%	Swiss-Prot	High
`Q8S3N1`	Arabidopsis thaliana	sp\|Q8S3N1\|SINA5_ARATH E3 ubiquitin-protein ligase SINAT5	69.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card