TkA08G233830 | RubberDandelionOmics

Gene overview

TkA08G233830

Reference: TK1151 Chr: Chr08 Coordinates: 60952324-60955130 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2153 bp · TkA08G233830|TK1151|cDNA

TTCTACCACACGTTTGCATTTTGCTATGCAAGATTGCAAGTGTGGCACCGTCACTGTTATGAGTTATCGTTTCAGAAAAGTGCCGCATCTGCATGCTCTGCACGCAACCCTTTCGTTCATGTTTAAATTCTGAAACCCAAATCAAAGATTAACCCAAGAAGTTTTCAAGTTTCCTCTGGATAATTTCCCCCAAAAGAACAAGAGATGAATGCAACGACATTGCAAGTTGTATCCCCTGTTCCGACAGATATAGACATCGC...

CDS

Download CDS FASTA

1899 bp · TkA08G233830|TK1151|CDS

ATGAATGCAACGACATTGCAAGTTGTATCCCCTGTTCCGACAGATATAGACATCGCGAATTCCGTCCAACCTCAACACATTTCCGCCATTGCCAAAAAGCTCAACCTCAATCCCAATCATTATGATCTCTATGGAAAATACAAGGCCAAGGTTTTGTTGCCTGTGATTGATGACCTCAAAGGACGACAAGATGGGTTCTATGTTGTGGTTGGAGGAATAACACCAACCCCTCTCGGAGAAGGCAAATCCACCACTACCGT...

Protein

Download Protein FASTA

632 aa · TkA08G233830|TK1151|PROTEIN

MNATTLQVVSPVPTDIDIANSVQPQHISAIAKKLNLNPNHYDLYGKYKAKVLLPVIDDLKGRQDGFYVVVGGITPTPLGEGKSTTTVGLCQALGAFLDKKVVTTLRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIDTRMFHESTQSDTALFNRLCPPNKHGTRTFNTIMHKRLKKLNIHKNLPEHLTPEEVNRFARLDIDPTTITWRRVMDVNDRFLRKITVGQGVDERGMVRETGFDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G233830`
TK1151 ID	TkA08G233830
OH-1004 ID	LXL04_033133
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G233830

Location Chr08:60952324-60955130 (-)

Description Similar to Formate--tetrahydrofolate ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50480`	Formate--tetrahydrofolate ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0006555 methionine metabolic process Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0009152 purine ribonucleotide biosynthetic process Biological Process

GO:0009257 10-formyltetrahydrofolate biosynthetic process Biological Process

GO:0019346 transsulfuration Biological Process

GO:0035713 response to nitrogen dioxide Biological Process

GO:0035999 tetrahydrofolate interconversion Biological Process

GO:0046655 folic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G50480

hsa:4522

mmu:108156

rno:64300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA08G233830 · TK1151

Nucleus0.192

Rank 2 · TkA08G233830 · TK1151

Mitochondrion0.132

Rank 3 · TkA08G233830 · TK1151

Cell membrane0.100

Rank 4 · TkA08G233830 · TK1151

Peroxisome0.077

Rank 5 · TkA08G233830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01268FTHFS14-632 aa

PF01656CbiA79-101 aa

PF22539DUF7004186-217 aa

PF23079HTH_NOL4_2nd513-552 aa

PF22539DUF7004517-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G233830	`PF01268`	FTHFS	14	632	9.7e-252	836.8
TkA08G233830	`PF01656`	CbiA	79	101	0.16	12.7
TkA08G233830	`PF22539`	DUF7004	186	217	0.1	13.4
TkA08G233830	`PF23079`	HTH_NOL4_2nd	513	552	0.26	12.5
TkA08G233830	`PF22539`	DUF7004	517	536	0.1	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPK5`	Arabidopsis thaliana	sp\|Q9SPK5\|FTHS_ARATH Formate--tetrahydrofolate ligase	80.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card