TkA08G232910 | RubberDandelionOmics

Gene overview

TkA08G232910

Reference: TK1151 Chr: Chr08 Coordinates: 60660469-60664716 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1215 bp · TkA08G232910|TK1151|cDNA

ATGGCTCTATTCCTATTCCGTCTCGTCTTTCTATCTATTTTCCTGCATTTCATAGGTGCAAAACAGAGTGACGGTTCTGTATCTATTGGTGCATCACTCACCGCCGCACCCGACATCAATCCATGGGTTTCATCTTCCGGTGAATTTGCCTTTGGATTCAAACAAGTTGAAGGGAGCAATAACTTCTTGTTATCCATATGGTATGAGAAGATACCCGACAAGACCGTCATCTGGTATCCAGTAGAAGGTCGGATGGTGCC...

CDS

Download CDS FASTA

1215 bp · TkA08G232910|TK1151|CDS

ATGGCTCTATTCCTATTCCGTCTCGTCTTTCTATCTATTTTCCTGCATTTCATAGGTGCAAAACAGAGTGACGGTTCTGTATCTATTGGTGCATCACTCACCGCCGCACCCGACATCAATCCATGGGTTTCATCTTCCGGTGAATTTGCCTTTGGATTCAAACAAGTTGAAGGGAGCAATAACTTCTTGTTATCCATATGGTATGAGAAGATACCCGACAAGACCGTCATCTGGTATCCAGTAGAAGGTCGGATGGTGCC...

Protein

Download Protein FASTA

404 aa · TkA08G232910|TK1151|PROTEIN

MALFLFRLVFLSIFLHFIGAKQSDGSVSIGASLTAAPDINPWVSSSGEFAFGFKQVEGSNNFLLSIWYEKIPDKTVIWYPVEGRMVPIGSRVKLLRGSGLVLTNPQGTHVWRSGSISGVASGSMNDTGNFVIFGSNSCKIWGSFDYPAHTLLPTQVMEMGGSINSTKSNTNLSGGRFQLRMLTNGNLILNTRNVLSGTPYVSYYRSDTLDDSNSTNFGEQMIFGVMGYMYILRRNGERFDLTVRGSLPSGDYYHRATLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G232910`
TK1151 ID	TkA08G232910
OH-1004 ID	LXL04_033119
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.600
Protein coverage (%)	TK1151 100.000 / OH-1004 50.879 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G232910

Location Chr08:60660469-60664716 (+)

Description Similar to LECRK3: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25AG3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202500`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`UniProt: A2XQD3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202300`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`UniProt: Q25AG2`	Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033119 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G60900

dosa:Os04g0202350

dosa:Os04g0202500

osa:9266608

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.431

Rank 1 · TkA08G232910 · TK1151

Cell membrane0.313

Rank 2 · TkA08G232910 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA08G232910 · TK1151

Cytoplasm0.068

Rank 4 · TkA08G232910 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA08G232910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin75-159 aa

PF01453B_lectin165-193 aa

PF00954S_locus_glycop251-324 aa

PF12662cEGF316-327 aa

PF00954S_locus_glycop368-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G232910	`PF01453`	B_lectin	75	159	1.2e-09	39.2
TkA08G232910	`PF01453`	B_lectin	165	193	1.2e-09	39.2
TkA08G232910	`PF00954`	S_locus_glycop	251	324	1.2e-05	26.5
TkA08G232910	`PF12662`	cEGF	316	327	0.057	14.0
TkA08G232910	`PF00954`	S_locus_glycop	368	382	1.2e-05	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q25AG3`	Oryza sativa subsp. indica	sp\|Q25AG3\|LERK3_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3	38.300%	Swiss-Prot	Medium
`Q0JEU6`	Oryza sativa subsp. japonica	sp\|Q0JEU6\|LERK3_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3	38.300%	Swiss-Prot	Medium
`A2XQD3`	Oryza sativa subsp. indica	sp\|A2XQD3\|LERK2_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	37.200%	Swiss-Prot	Medium
`Q7FAZ2`	Oryza sativa subsp. japonica	sp\|Q7FAZ2\|LERK2_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	37.700%	Swiss-Prot	Medium
`Q25AG2`	Oryza sativa subsp. indica	sp\|Q25AG2\|LERK4_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4	39.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card