RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G232460
Reference: TK1151 Chr: Chr08 Coordinates: 60542177-60544630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2256 bp · TkA08G232460|TK1151|cDNA

ATGGCTCTAATCCTACTGCACCTCATCTTTCTATCTATTTTCCTACATTTGATAACTGCACAACAGACTGGCGGCTCTGTATCTGTTGGTTCATCACTCACCGCCACACCCGACGTTAACCCATGGGTACTTTCATCTTCCGGTGAGTTTGCCTTTGGGTTTAAACAAATTGAAGGGACCGATTACTTTTTGTTGTCAATATGGTATGACAAGATACCCGACAAGACCATCATCTGGTATCCAGAAGAAGGTAAGATGGT...

CDS

Download CDS FASTA

2256 bp · TkA08G232460|TK1151|CDS

ATGGCTCTAATCCTACTGCACCTCATCTTTCTATCTATTTTCCTACATTTGATAACTGCACAACAGACTGGCGGCTCTGTATCTGTTGGTTCATCACTCACCGCCACACCCGACGTTAACCCATGGGTACTTTCATCTTCCGGTGAGTTTGCCTTTGGGTTTAAACAAATTGAAGGGACCGATTACTTTTTGTTGTCAATATGGTATGACAAGATACCCGACAAGACCATCATCTGGTATCCAGAAGAAGGTAAGATGGT...

Protein

Download Protein FASTA

751 aa · TkA08G232460|TK1151|PROTEIN

MALILLHLIFLSIFLHLITAQQTGGSVSVGSSLTATPDVNPWVLSSSGEFAFGFKQIEGTDYFLLSIWYDKIPDKTIIWYPEEGKMVPTGSKVELVRTTGLVLSDPQGTEVWRSGSISGVASGFMNDTGNFVIFGSNSRKIWDTFDFPANTLLPTQVMETGEGIKSTMSKTNFSGGRFQLRLLQDGNLVLNTRDILSGSPYDAYYISGTFDPSNSTNSGEQLIFDEMGYMYILRRSGERFDLTPNGSLPSGDYYHRAALD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G232460
TK1151 IDTkA08G232460
OH-1004 IDLXL04_033119
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)92.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G232460
LocationChr08:60542177-60544630 (+)
DescriptionSimilar to LECRK3: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60900 G-type lectin S-receptor-like serine/threonine-protein kinase RLK1. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0202500 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
UniProt: Q25AG3 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
UniProt: A2XQD3 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
Os04g0202300 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033119 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0051707 response to other organism Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
GO:0031625 ubiquitin protein ligase binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G60900
dosa:Os04g0202350
dosa:Os04g0202500
osa:9266608
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.765
Rank 1 · TkA08G232460 · TK1151
Endoplasmic reticulum0.086
Rank 2 · TkA08G232460 · TK1151
Cytoplasm0.074
Rank 3 · TkA08G232460 · TK1151
Extracellular0.062
Rank 4 · TkA08G232460 · TK1151
Lysosome / Vacuole0.039
Rank 5 · TkA08G232460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin76-160 aa
PF01453B_lectin166-192 aa
PF00954S_locus_glycop253-321 aa
PF14670FXa_inhibition295-324 aa
PF12947EGF_3295-321 aa
PF12661hEGF301-320 aa
PF08276PAN_2347-398 aa
PF07714PK_Tyr_Ser-Thr466-731 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G232460PF01453B_lectin761608.2e-0936.6
TkA08G232460PF01453B_lectin1661928.2e-0936.6
TkA08G232460PF00954S_locus_glycop2533217.5e-0730.4
TkA08G232460PF14670FXa_inhibition2953240.2412.3
TkA08G232460PF12947EGF_32953210.411.7
TkA08G232460PF12661hEGF3013203.49.0
TkA08G232460PF08276PAN_23473980.0002621.7
TkA08G232460PF07714PK_Tyr_Ser-Thr4667319.8e-45153.6
TkA08G232460PF00069Pkinase4677299e-47160.4
TkA08G232460PF01636APH5115400.212.1
TkA08G232460PF12260PIP49_C5186040.03414.5
TkA08G232460PF07387Seadorna_VP75686050.1112.2
TkA08G232460PF03109ABC15716130.0513.5
TkA08G232460PF01636APH5746060.212.1
TkA08G232460PF17667Pkinase_fungal5786470.1411.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39202Arabidopsis thalianasp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK144.100%Swiss-ProtMedium
Q0JEU6Oryza sativa subsp. japonicasp|Q0JEU6|LERK3_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK343.200%Swiss-ProtMedium
Q25AG3Oryza sativa subsp. indicasp|Q25AG3|LERK3_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK343.100%Swiss-ProtMedium
A2XQD3Oryza sativa subsp. indicasp|A2XQD3|LERK2_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK242.200%Swiss-ProtMedium
Q7FAZ2Oryza sativa subsp. japonicasp|Q7FAZ2|LERK2_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK241.900%Swiss-ProtMedium

JBrowse

View in Genome Browser