TkA08G229740 | RubberDandelionOmics

Gene overview

TkA08G229740

Reference: TK1151 Chr: Chr08 Coordinates: 59890557-59897117 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1815 bp · TkA08G229740|TK1151|cDNA

AAATATTATCGTTGTTAATCCGTTGGCGTTCTGTAACTAACTTAAGGGAATGAAAGTGTGAATTGAAGATTTTGTCCTCCAATCAATTGGCTAATTATTATGGCTGAGAAAAACGATGGATGTCCATGTGGAAGTGGAAATCTACCAAGACTTCCCATCTCCATTTTCTTTAAAGATGCCAAGTTAGCACTAAAAATGGATGAACTTGGCCTTGAAATAGCAAAAATTGCCTTACCGGCAGCACTTGCTTTGACAGCCGA...

CDS

Download CDS FASTA

1515 bp · TkA08G229740|TK1151|CDS

ATGGCTGAGAAAAACGATGGATGTCCATGTGGAAGTGGAAATCTACCAAGACTTCCCATCTCCATTTTCTTTAAAGATGCCAAGTTAGCACTAAAAATGGATGAACTTGGCCTTGAAATAGCAAAAATTGCCTTACCGGCAGCACTTGCTTTGACAGCCGATCCTATTGCCTCTCTTGTGGACACAGCCTTCATCGGTCAAATTGGTGCGACTGAACTAGCTGCTGTAGGAGTTTCTATAGCTGTTTTCAACCAAGTATC...

Protein

Download Protein FASTA

504 aa · TkA08G229740|TK1151|PROTEIN

MAEKNDGCPCGSGNLPRLPISIFFKDAKLALKMDELGLEIAKIALPAALALTADPIASLVDTAFIGQIGATELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDTITNSTHQMQEPTTDSENKKLLELQNIKSESLDEESLTTSYEKKRIPSASSAIIIGLILGFLQAVFLITGAKPILGIMGIKSDSPMMYPAQQYLKLRSLGAPAVLLSLAMQGVFRGFKDTKTPLYATLAGDVTNIILDPIFIFVFGLGVSGAAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G229740`
TK1151 ID	TkA08G229740
OH-1004 ID	LXL04_033092
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 97.024 / OH-1004 48.947 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G229740

Location Chr08:59890557-59897117 (+)

Description Similar to DTX42: Protein DETOXIFICATION 42

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51340`	Citrate transporter critical for aluminum tolerance.	Aluminum-activated citrate and malate transporters from the MATE and ALMT families function independently to confer Arabidopsis aluminum tolerance.2009 · DOI: 10.1111/j.1365-313x.2008.03696.x A promoter-swap strategy between the AtALMT and AtMATE genes increased Arabidopsis aluminum resistance and improved carbon-use efficiency for aluminum resistance.2012 · DOI: 10.1111/j.1365-313x.2012.04994.x
`At3g08040`	Citrate transporter responsible for loading citrate into xylem tissues, which helps facilitate iron transport to shoots.	FRD3, a member of the multidrug and toxin efflux family, controls iron deficiency responses in Arabidopsis.2002 · DOI: 10.1105/tpc.001495 FRD3 controls iron localization in Arabidopsis.2004 · DOI: 10.1104/pp.104.045633 The FRD3-mediated efflux of citrate into the root vasculature is necessary for efficient iron translocation.2007 · DOI: 10.1104/pp.107.097162 The FRD3 citrate effluxer promotes iron nutrition between symplastically disconnected tissues throughout Arabidopsis development.2011 · DOI: 10.1105/tpc.111.088088
`At2g38330`	Protein DETOXIFICATION 44, chloroplastic.	No verified direct reference in this release
`At4g38380`	Protein DETOXIFICATION 45, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033092 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0015695 organic cation transport Biological Process

GO:0015746 citrate transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030001 metal ion transport Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G51340

ath:AT2G38330

ath:AT3G08040

ath:AT4G38380

dre:560024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.392

Rank 1 · TkA08G229740 · TK1151

Cell membrane0.291

Rank 2 · TkA08G229740 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA08G229740 · TK1151

Golgi apparatus0.089

Rank 4 · TkA08G229740 · TK1151

Cytoplasm0.079

Rank 5 · TkA08G229740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02810SEC-C5-13 aa

PF01554MatE46-91 aa

PF01554MatE155-246 aa

PF01554MatE248-268 aa

PF01554MatE309-461 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G229740	`PF02810`	SEC-C	5	13	6.1	7.5
TkA08G229740	`PF01554`	MatE	46	91	1.2e-26	94.0
TkA08G229740	`PF01554`	MatE	155	246	1.2e-26	94.0
TkA08G229740	`PF01554`	MatE	248	268	1.2e-26	94.0
TkA08G229740	`PF01554`	MatE	309	461	1.2e-26	94.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYD6`	Arabidopsis thaliana	sp\|Q9SYD6\|DTX42_ARATH Protein DETOXIFICATION 42	70.100%	Swiss-Prot	High
`Q9SFB0`	Arabidopsis thaliana	sp\|Q9SFB0\|DTX43_ARATH Protein DETOXIFICATION 43	57.200%	Swiss-Prot	High
`Q84K71`	Arabidopsis thaliana	sp\|Q84K71\|DTX44_ARATH Protein DETOXIFICATION 44, chloroplastic	47.500%	Swiss-Prot	Medium
`Q9SVE7`	Arabidopsis thaliana	sp\|Q9SVE7\|DTX45_ARATH Protein DETOXIFICATION 45, chloroplastic	42.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card