TkA08G229690 | RubberDandelionOmics

Gene overview

TkA08G229690

Reference: TK1151 Chr: Chr08 Coordinates: 59877420-59879862 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1216 bp · TkA08G229690|TK1151|cDNA

GTTGGACCATTTTGGACCTCAAATTTATTTCTGGCCATTCTTCCCCACAAATTCCTTGTTTCCCCACACGCCTTCTCTTACCCACCAAAACACAATCACCTTCTTCACTCCTTCCTCAAGAGATTCTCATTTCTCAATTCTCACGCATGAATCTTTGACTTCAATCGTCAATTTCAAATTTCCTTTCACACCCACCAAAATTCTCATTTGTATCTCAGCCGGGTGTTTATTGTTTTGTTGTTTGATTCCGATTTGGGTAA...

CDS

Download CDS FASTA

624 bp · TkA08G229690|TK1151|CDS

ATGGTGGGTGGCATGCGTGTTGTGGGTTCCCCCATTGTGGATTCACATACTTCACCATGTTTGTGTCTCGATAGTACGCTTATTTCAACGCATATGAATCACTCAAGCAATGGTGATTTGAATTTACAAAGGAAATCGATCAGTAAAAAGCTGAGTTCTTCTTTCGTCGATTCCAGGCTTCCATCGAGGGCAATTGCTTCCCAGAAGCAGAAGAGGGCTAGAAGTTTTGTGATCGTCAATGAACTTGGTGGGCAGTATGA...

Protein

Download Protein FASTA

207 aa · TkA08G229690|TK1151|PROTEIN

MVGGMRVVGSPIVDSHTSPCLCLDSTLISTHMNHSSNGDLNLQRKSISKKLSSSFVDSRLPSRAIASQKQKRARSFVIVNELGGQYDESFSDVKAQIFNLFTYKAVRTVMNQLYEMNPTEYRWFYDFVASNQPIDGKRFIRVLQKEKHELAERVMVTRLHLLGKWVKKLDHAEMYKDFSDQNLELMRERLMQTVIWPSDDTNTEKIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G229690`
TK1151 ID	TkA08G229690
OH-1004 ID	LXL04_033090
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G229690

Location Chr08:59877420-59879862 (+)

Description Similar to RBCX2: Chaperonin-like RbcX protein 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19855`	Chaperone involved in RuBisCO assembly process.	Initial characteristics of RbcX proteins from Arabidopsis thaliana.2011 · DOI: 10.1007/s11103-011-9823-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0015977 carbon fixation Biological Process

GO:0015979 photosynthesis Biological Process

GO:0110102 ribulose bisphosphate carboxylase complex assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

GO:0044183 protein folding chaperone Molecular Function

KEGG gene cross-reference

ath:AT5G19855

tel:tll1505

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA08G229690 · TK1151

Nucleus0.044

Rank 2 · TkA08G229690 · TK1151

Mitochondrion0.035

Rank 3 · TkA08G229690 · TK1151

Cytoplasm0.017

Rank 4 · TkA08G229690 · TK1151

Cell membrane0.013

Rank 5 · TkA08G229690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08017Fibrinogen_BP23-54 aa

PF02341RbcX96-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G229690	`PF08017`	Fibrinogen_BP	23	54	0.19	10.7
TkA08G229690	`PF02341`	RbcX	96	193	8.5e-17	62.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9X2`	Arabidopsis thaliana	sp\|Q8L9X2\|RBCX2_ARATH Chaperonin-like RbcX protein 2, chloroplastic	53.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card