TkA08G220950 | RubberDandelionOmics

Gene overview

TkA08G220950

Reference: TK1151 Chr: Chr08 Coordinates: 57783682-57784122 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA08G220950|TK1151|cDNA

CGATGCGATTCAAGCAACACCAAATTCTGTTACTACAACAACTACAATCTCTCACAGCCTCGCCATTTCTGTAAAAACTGCCGCCGCTACTGGACCAAAGGCGGCACGCTCCGTAACATCCCTATCGGTGGCGCTACTCGCAAAATCAACAAACGCTCTTCAAATCCAACTAAACGCACTTCACCGGCACCACCACCGGCTGCACCTCCACTTTCGCTGAAACAGGAGCCGTGTGTTGGTTATGGATATGGCAATAATCA...

CDS

Download CDS FASTA

411 bp · TkA08G220950|TK1151|CDS

CGATGCGATTCAAGCAACACCAAATTCTGTTACTACAACAACTACAATCTCTCACAGCCTCGCCATTTCTGTAAAAACTGCCGCCGCTACTGGACCAAAGGCGGCACGCTCCGTAACATCCCTATCGGTGGCGCTACTCGCAAAATCAACAAACGCTCTTCAAATCCAACTAAACGCACTTCACCGGCACCACCACCGGCTGCACCTCCACTTTCGCTGAAACAGGAGCCGTGTGTTGGTTATGGATATGGCAATAATCA...

Protein

Download Protein FASTA

136 aa · TkA08G220950|TK1151|PROTEIN

RCDSSNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGTLRNIPIGGATRKINKRSSNPTKRTSPAPPPAAPPLSLKQEPCVGYGYGNNQHMEANIGNLSSLLGANPMGPFGNLLIDGLSSNLASKSDDDVLIRTPIAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G220950`
TK1151 ID	TkA08G220950
OH-1004 ID	LXL04_002133
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.300
Protein coverage (%)	TK1151 99.265 / OH-1004 67.442 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G220950

Location Chr08:57783682-57784122 (+)

Description Similar to DOF1.7: Dof zinc finger protein DOF1.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45610`	Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes.	Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.2012 · DOI: 10.1093/jxb/err388 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At1g51700`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At3g50410`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At3g21270`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045787 positive regulation of cell cycle Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G51700

ath:AT3G45610

ath:AT3G50410

ath:AT5G60200

ath:AT5G66940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · TkA08G220950 · TK1151

Cytoplasm0.205

Rank 2 · TkA08G220950 · TK1151

Mitochondrion0.023

Rank 3 · TkA08G220950 · TK1151

Cell membrane0.018

Rank 4 · TkA08G220950 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA08G220950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701Zn_ribbon_Dof1-51 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G220950	`PF02701`	Zn_ribbon_Dof	1	51	3.7e-30	104.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1E6`	Arabidopsis thaliana	sp\|Q9M1E6\|DOF32_ARATH Dof zinc finger protein DOF3.2	52.800%	Swiss-Prot	High
`O82155`	Arabidopsis thaliana	sp\|O82155\|DOF17_ARATH Dof zinc finger protein DOF1.7	87.300%	Swiss-Prot	Low
`Q84TE9`	Arabidopsis thaliana	sp\|Q84TE9\|DOF53_ARATH Dof zinc finger protein DOF5.3	46.500%	Swiss-Prot	Medium
`Q39088`	Arabidopsis thaliana	sp\|Q39088\|DOF34_ARATH Dof zinc finger protein DOF3.4	83.000%	Swiss-Prot	Low
`Q94AR6`	Arabidopsis thaliana	sp\|Q94AR6\|DOF31_ARATH Dof zinc finger protein DOF3.1	73.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card