TkA08G220920 | RubberDandelionOmics

Gene overview

TkA08G220920

Reference: TK1151 Chr: Chr08 Coordinates: 57759008-57760835 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1475 bp · TkA08G220920|TK1151|cDNA

AAAACAGTTTGTATGCACGTAGAGAGAACACAAGGCATTACATGTTCGTTCCACTTCTCTGGGGAAGAAGTTTCTCAATAACCGCATCGTCTCCCCTCCTCTGTCCTTTAATTAATTCTTGTCTTAATTCTTTCACAGTCGTTAATCATTTATTTCATTAATTTGACAAGACAATCTGTGAGTATACGTACACTTTCCTATATATAATCATCCCACCCTACTCCATCGGCTCCCTATCTCACTCTCTCTTCAAGGTCTCT...

CDS

Download CDS FASTA

987 bp · TkA08G220920|TK1151|CDS

ATGGCGAAGAAGAAGAACGAAAACAACAACAATAACAACAATGAGAAGGACGATAGCAGTGGAAAGAAGCAGAAAGCTTCTGGTGGTGTTACAGTGGTAGTTCTGAAAATGGACCTGCACTGCGAAGGCTGCGCCGGTAGAGTCGTTAAAGCTGTTCGTACTCTCGATGGTGTTGAGTCTGTGAGAATCGGTGACAGTGAGCTCAACAAAATCACAGTGATCGGAAGCCTCGATCCGGCGATACTCCGGAAAAAAGTCGA...

Protein

Download Protein FASTA

328 aa · TkA08G220920|TK1151|PROTEIN

MAKKKNENNNNNNNEKDDSSGKKQKASGGVTVVVLKMDLHCEGCAGRVVKAVRTLDGVESVRIGDSELNKITVIGSLDPAILRKKVEEKTKKKVELISPATKKNNDGENNGGGGGGGDNKKKQQKPPQENQQPPSDNAKNAVKKDEKKPKEIPVTTAVLKVPLHCQGCVRKIQKVVSKTKGYMDMSIDMNKDFVTVKGAIDMKILAEVLKQKLKRAVEIVQPKKDGGDGGGDKKGKGGGDKKGKGGGGGNDADEKGGGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G220920`
TK1151 ID	TkA08G220920
OH-1004 ID	LXL04_033014
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 91.159 / OH-1004 91.185 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G220920

Location Chr08:57759008-57760835 (-)

Description Similar to HIPP03: Heavy metal-associated isoprenylated plant protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60800`	Heavy-metal-binding protein.	The zinc-binding nuclear protein HIPP3 acts as an upstream regulator of the salicylate-dependent plant immunity pathway and of flowering time in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13419
`At2g28090`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g03380`	Heavy-metal-binding protein.	Functional characterization of a heavy metal binding protein CdI19 from Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01412.x
`At3g02960`	Heavy-metal-binding protein.	No verified direct reference in this release
`At2g36950`	Heavy-metal-binding protein (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033014 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009910 negative regulation of flower development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G28090

ath:AT2G36950

ath:AT3G02960

ath:AT5G03380

ath:AT5G60800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.478

Rank 1 · TkA08G220920 · TK1151

Cytoplasm0.419

Rank 2 · TkA08G220920 · TK1151

Nucleus0.324

Rank 3 · TkA08G220920 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA08G220920 · TK1151

Golgi apparatus0.026

Rank 5 · TkA08G220920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15305IFT434-27 aa

PF00403HMA37-89 aa

PF04324Fer2_BFD41-49 aa

PF04324Fer2_BFD149-176 aa

PF00403HMA159-215 aa

PF15305IFT43177-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G220920	`PF15305`	IFT43	4	27	1.9	9.4
TkA08G220920	`PF00403`	HMA	37	89	6.8e-17	62.3
TkA08G220920	`PF04324`	Fer2_BFD	41	49	0.22	12.6
TkA08G220920	`PF04324`	Fer2_BFD	149	176	0.22	12.6
TkA08G220920	`PF00403`	HMA	159	215	6.8e-17	62.3
TkA08G220920	`PF15305`	IFT43	177	211	1.9	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJH5`	Arabidopsis thaliana	sp\|Q9FJH5\|HIP3_ARATH Heavy metal-associated isoprenylated plant protein 3	52.000%	Swiss-Prot	High
`Q9ZUV1`	Arabidopsis thaliana	sp\|Q9ZUV1\|HIP1_ARATH Heavy metal-associated isoprenylated plant protein 1	39.700%	Swiss-Prot	Medium
`Q9LZF1`	Arabidopsis thaliana	sp\|Q9LZF1\|HIP6_ARATH Heavy metal-associated isoprenylated plant protein 6	50.700%	Swiss-Prot	Medium
`Q9M8T7`	Arabidopsis thaliana	sp\|Q9M8T7\|HIP8_ARATH Heavy metal-associated isoprenylated plant protein 8	30.700%	Swiss-Prot	Medium
`Q9SJL2`	Arabidopsis thaliana	sp\|Q9SJL2\|HIP5_ARATH Heavy metal-associated isoprenylated plant protein 5	47.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card