TkA08G216000 | RubberDandelionOmics

Gene overview

TkA08G216000

Reference: TK1151 Chr: Chr08 Coordinates: 56520033-56522923 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · TkA08G216000|TK1151|cDNA

GAAAAGGTCAACGTGTCCAAAGATACTTAACTGGCTCGCGCTATAACCAAATAACCATCGCCTGATAAAACTCACGACAGTCCCTGACTCCGCCATTTTTACACAGCAACAAAGCTCTCCATAGAGGTGAAAAAACCTTATTAATGGTGGTTTAAGCTTCAACGCCGAGATCTCACGGCTTCTCTCTGAAACTTTGGTCTACCTCTGAAAACTCATTTTCCTCTGATAACATGCGGTCGAAAGACAGAATTTCCTACTTC...

CDS

Download CDS FASTA

1290 bp · TkA08G216000|TK1151|CDS

ATGCGGTCGAAAGACAGAATTTCCTACTTCTACGATGGGGATGTCGGTAATGTTTACTTTGGTCCTAACCATCCAATGAAGCCGCATCGTTTATGCATGACTCATCATTTGGTGCTCTCTTATGAACTTCACAAGAAGATGGAAATCTATAGGCCTCATAAGGCATATCCAGTTGAACTAGCTCAGTTTCACTCAGCCGATTATGTCGAGTTCTTGCAAAGAATAAACCCTGACACAACAAATTTGTTTCCAGAAGAAAT...

Protein

Download Protein FASTA

429 aa · TkA08G216000|TK1151|PROTEIN

MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVELAQFHSADYVEFLQRINPDTTNLFPEEMAKFKLGEDCPVFDDLFEFCQIYAGGTLDAARRLNNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDRVMTVSFHKYGNMFFPGSGDVKEIGEREGKFYAINVPLKDGIDDGSFTRLFKTIIAKVVEIYQPGVIVLQCGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G216000`
TK1151 ID	TkA08G216000
OH-1004 ID	LXL04_032957
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G216000

Location Chr08:56520033-56522923 (-)

Description Similar to HDA9: Histone deacetylase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g44680`	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032957 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001975 response to amphetamine Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0010187 negative regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT3G44680

bta:404126

gga:373961

mmu:433759

rno:297893

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.724

Rank 1 · TkA08G216000 · TK1151

Cytoplasm0.471

Rank 2 · TkA08G216000 · TK1151

Mitochondrion0.043

Rank 3 · TkA08G216000 · TK1151

Cell membrane0.029

Rank 4 · TkA08G216000 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA08G216000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00850Hist_deacetyl24-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G216000	`PF00850`	Hist_deacetyl	24	314	1.9e-86	290.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0W2`	Arabidopsis thaliana	sp\|Q8H0W2\|HDA9_ARATH Histone deacetylase 9	83.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card