TkA08G215610 | RubberDandelionOmics

Gene overview

TkA08G215610

Reference: TK1151 Chr: Chr08 Coordinates: 56426200-56427609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · TkA08G215610|TK1151|cDNA

ATGGCTGAAAGGAATGTGGGTTCTTCGTCTTCCATTGGGTTTCTATCAATGAAATCGTTGTTCTGTTTGTTGTCAGCGGCATTAATGGTGTTCGTGTTATCGTGGTTCTTACTTTTAAGCTCCGACGGCCGGTCTCGACTCATCGATCACAGTCTATTACCCCATTCGAAGACGCACAATGCTCCACCGATTGCTCATCAACAACCAGCAACTCTTAAAGTCTTTATGTACGATTTACCCCCAGAATTCCATTTCGAGAT...

CDS

Download CDS FASTA

1365 bp · TkA08G215610|TK1151|CDS

ATGGCTGAAAGGAATGTGGGTTCTTCGTCTTCCATTGGGTTTCTATCAATGAAATCGTTGTTCTGTTTGTTGTCAGCGGCATTAATGGTGTTCGTGTTATCGTGGTTCTTACTTTTAAGCTCCGACGGCCGGTCTCGACTCATCGATCACAGTCTATTACCCCATTCGAAGACGCACAATGCTCCACCGATTGCTCATCAACAACCAGCAACTCTTAAAGTCTTTATGTACGATTTACCCCCAGAATTCCATTTCGAGAT...

Protein

Download Protein FASTA

454 aa · TkA08G215610|TK1151|PROTEIN

MAERNVGSSSSIGFLSMKSLFCLLSAALMVFVLSWFLLLSSDGRSRLIDHSLLPHSKTHNAPPIAHQQPATLKVFMYDLPPEFHFEILYWKAEGKSVWPDIRSKVPEYPGGLNLQHSVAYWLTLDLLASSGQTAVRVRNSSEADVIFVPFFSSICFNRFSRLNPHQNTNRNRELQQKLVKYLTGQPEWQRSGGIDHIIVAHHPNSLLDARYQLWPAMFILSDFGRYPPTIANIDKDLIAPYKHIIKSYTNDSSTFDTRPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G215610`
TK1151 ID	TkA08G215610
OH-1004 ID	LXL04_032948
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G215610

Location Chr08:56426200-56427609 (-)

Description Similar to ARAD1: Probable arabinosyltransferase ARAD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35100`	Probable arabinosyl transferase responsible for the polymerization of arabinose into the arabinan of arabinogalactan.	ARABINAN DEFICIENT 1 is a putative arabinosyltransferase involved in biosynthesis of pectic arabinan in Arabidopsis.2006 · DOI: 10.1104/pp.105.072744 Cell wall pectic arabinans influence the mechanical properties of Arabidopsis thaliana inflorescence stems and their response to mechanical stress.2013 · DOI: 10.1093/pcp/pct074
`At5g44930`	Probable arabinosyl transferase responsible for the polymerization of arabinose into the arabinan of arabinogalactan.	Cell wall pectic arabinans influence the mechanical properties of Arabidopsis thaliana inflorescence stems and their response to mechanical stress.2013 · DOI: 10.1093/pcp/pct074

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0926700`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os02g0520750`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os04g0398600`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0035884 arabinan biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G35100

ath:AT5G44930

dosa:Os01g0926400

dosa:Os01g0926700

dosa:Os02g0520750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.832

Rank 1 · TkA08G215610 · TK1151

Endoplasmic reticulum0.085

Rank 2 · TkA08G215610 · TK1151

Cell membrane0.047

Rank 3 · TkA08G215610 · TK1151

Cytoplasm0.045

Rank 4 · TkA08G215610 · TK1151

Extracellular0.041

Rank 5 · TkA08G215610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016Exostosin_GT4771-369 aa

PF27279DdaG_C390-429 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G215610	`PF03016`	Exostosin_GT47	71	369	5.4e-63	213.8
TkA08G215610	`PF27279`	DdaG_C	390	429	0.32	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DBG8`	Arabidopsis thaliana	sp\|Q6DBG8\|ARAD1_ARATH Probable arabinosyltransferase ARAD1	39.800%	Swiss-Prot	Medium
`Q9FLA5`	Arabidopsis thaliana	sp\|Q9FLA5\|ARAD2_ARATH Probable arabinosyltransferase ARAD2	38.800%	Swiss-Prot	Medium
`Q8S1X7`	Oryza sativa subsp. japonica	sp\|Q8S1X7\|GT15_ORYSJ Probable glucuronosyltransferase Os01g0926700	26.000%	Swiss-Prot	Low
`Q6H4N0`	Oryza sativa subsp. japonica	sp\|Q6H4N0\|GT21_ORYSJ Probable glucuronosyltransferase Os02g0520750	24.900%	Swiss-Prot	Low
`Q7XLG3`	Oryza sativa subsp. japonica	sp\|Q7XLG3\|GT42_ORYSJ Probable glucuronosyltransferase Os04g0398600	24.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card