TkA08G214860 | RubberDandelionOmics

Gene overview

TkA08G214860

Reference: TK1151 Chr: Chr08 Coordinates: 56217548-56226044 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

817 bp · TkA08G214860|TK1151|cDNA

GAAACACTTTCTGTCACTGTTGTAAGTTTACCATCGCATGATTGTAACCTTACTTGTAACTAAAGTGTTATAAATAGCTACTATCTAGGGTCTCTTTAACCTGCAAAAGTTTCCCAGTTTGTTGAGGGTTCGAATCAATGGCAAGACAAAGGCGAGATCATCCCCTGGTGATCGGGAGGGTGGTCGGAGATGTAGTTGACAGTTTCACTCCCAGTGTGAATATGCTTGTAATGTACAACAAATCGAACCAAGTGTACAAT...

CDS

Download CDS FASTA

528 bp · TkA08G214860|TK1151|CDS

ATGGCAAGACAAAGGCGAGATCATCCCCTGGTGATCGGGAGGGTGGTCGGAGATGTAGTTGACAGTTTCACTCCCAGTGTGAATATGCTTGTAATGTACAACAAATCGAACCAAGTGTACAATGGGTATGAGCTGTTGCCTTCTTCTGTCACTGGTAAACCTAAGGTCGGTGTTCATGGTGGTGACATGAGATCCTTTTTTACACTGATAATGACAGATCCAGATGTTCCTGGTCCTAGCGATCCATATCTCAGAGAGCA...

Protein

Download Protein FASTA

175 aa · TkA08G214860|TK1151|PROTEIN

MARQRRDHPLVIGRVVGDVVDSFTPSVNMLVMYNKSNQVYNGYELLPSSVTGKPKVGVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTDSSFGKELVSYEMPKPNIGIHRYVFLLFKQNGRQTVSCPSSRDRFNTRMFAQENDLGLPVGGIFFNCQRETAARRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G214860`
TK1151 ID	TkA08G214860
OH-1004 ID	LXL04_013157
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.500
Protein coverage (%)	TK1151 97.714 / OH-1004 98.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G214860

Location Chr08:56217548-56226044 (-)

Description Similar to CET2: CEN-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27550`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G27550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.522

Rank 1 · TkA08G214860 · TK1151

Cytoplasm0.499

Rank 2 · TkA08G214860 · TK1151

Extracellular0.156

Rank 3 · TkA08G214860 · TK1151

Mitochondrion0.061

Rank 4 · TkA08G214860 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA08G214860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01161PBP54-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G214860	`PF01161`	PBP	54	161	4.2e-15	57.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZNV5`	Arabidopsis thaliana	sp\|Q9ZNV5\|CEN_ARATH Protein CENTRORADIALIS-like	74.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card