TkA08G213290 | RubberDandelionOmics

Gene overview

TkA08G213290

Reference: TK1151 Chr: Chr08 Coordinates: 55811029-55811682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · TkA08G213290|TK1151|cDNA

ATGATTGTCGGTTTTGCTTCCCATGGGCATGCAATGAAGGCTCTAAGTTTTTTCAAAGAGATGATAGGAACAGGATTATACAAACCAGATGAGATTACATTCATTGGTGTACTATCGGCTTGTAGTCATGGAGGGTTACTCACTCAAGGAAGAAGCTACTTCAACGAGATGGAGACCACATTTGGGTTAAAACCAAGAGTGGAGCATTATGCTTGTATGATTGATTTACTTGGAAGAATTGGGCTTTTAAATGAAGCTTA...

CDS

Download CDS FASTA

654 bp · TkA08G213290|TK1151|CDS

ATGATTGTCGGTTTTGCTTCCCATGGGCATGCAATGAAGGCTCTAAGTTTTTTCAAAGAGATGATAGGAACAGGATTATACAAACCAGATGAGATTACATTCATTGGTGTACTATCGGCTTGTAGTCATGGAGGGTTACTCACTCAAGGAAGAAGCTACTTCAACGAGATGGAGACCACATTTGGGTTAAAACCAAGAGTGGAGCATTATGCTTGTATGATTGATTTACTTGGAAGAATTGGGCTTTTAAATGAAGCTTA...

Protein

Download Protein FASTA

217 aa · TkA08G213290|TK1151|PROTEIN

MIVGFASHGHAMKALSFFKEMIGTGLYKPDEITFIGVLSACSHGGLLTQGRSYFNEMETTFGLKPRVEHYACMIDLLGRIGLLNEAYELITEMPMEADKVVWGAVLNACRMHGNVELGRLATEKLLKLDPNDSSVYMLMESLCASRRKWDDVKMIRSMMRENGVKKTPGCSSVEVEGVFHQFLVSDKSHPKSDHIYQVLGEITSLSRLEQFNKLLID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G213290`
TK1151 ID	TkA08G213290
OH-1004 ID	LXL04_032920
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 34.609 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G213290

Location Chr08:55811029-55811682 (+)

Description Similar to PCMP-E28: Pentatricopeptide repeat-containing protein At2g22410, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22410`	Pentatricopeptide repeat-containing protein At2g22410, mitochondrial.	No verified direct reference in this release
`At5g48910`	Pentatricopeptide repeat-containing protein At5g48910.	No verified direct reference in this release
`At1g08070`	Involved in multiple sites RNA editing events in chloroplasts.	No verified direct reference in this release
`At3g29230`	Pentatricopeptide repeat-containing protein At3g29230.	No verified direct reference in this release
`At5g59200`	Involved in RNA editing event in chloroplasts.	A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032920 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0016556 mRNA modification Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G13600

ath:AT2G22410

ath:AT2G29760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.633

Rank 1 · TkA08G213290 · TK1151

Plastid0.205

Rank 2 · TkA08G213290 · TK1151

Nucleus0.056

Rank 3 · TkA08G213290 · TK1151

Cytoplasm0.042

Rank 4 · TkA08G213290 · TK1151

Peroxisome0.008

Rank 5 · TkA08G213290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR1-24 aa

PF13041PPR_21-42 aa

PF12854PPR_11-21 aa

PF29070MSC6_N7-91 aa

PF12854PPR_128-34 aa

PF01535PPR33-58 aa

PF13041PPR_252-58 aa

PF12854PPR_162-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G213290	`PF01535`	PPR	1	24	9.3e-14	51.3
TkA08G213290	`PF13041`	PPR_2	1	42	3.3e-10	40.6
TkA08G213290	`PF12854`	PPR_1	1	21	1.2e-07	32.0
TkA08G213290	`PF29070`	MSC6_N	7	91	0.003	17.5
TkA08G213290	`PF12854`	PPR_1	28	34	1.2e-07	32.0
TkA08G213290	`PF01535`	PPR	33	58	9.3e-14	51.3
TkA08G213290	`PF13041`	PPR_2	52	58	3.3e-10	40.6
TkA08G213290	`PF12854`	PPR_1	62	93	1.2e-07	32.0
TkA08G213290	`PF13041`	PPR_2	67	94	3.3e-10	40.6
TkA08G213290	`PF01535`	PPR	70	94	9.3e-14	51.3
TkA08G213290	`PF13428`	TPR_14	73	90	0.33	12.5
TkA08G213290	`PF13041`	PPR_2	98	116	3.3e-10	40.6
TkA08G213290	`PF01535`	PPR	100	116	9.3e-14	51.3
TkA08G213290	`PF13428`	TPR_14	101	138	0.33	12.5
TkA08G213290	`PF20431`	E_motif	112	174	1.8e-17	64.0
TkA08G213290	`PF29070`	MSC6_N	127	162	0.003	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJZ3`	Arabidopsis thaliana	sp\|Q9SJZ3\|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial	55.300%	Swiss-Prot	High
`Q9FI80`	Arabidopsis thaliana	sp\|Q9FI80\|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910	45.300%	Swiss-Prot	Medium
`Q9LN01`	Arabidopsis thaliana	sp\|Q9LN01\|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070, chloroplastic	46.300%	Swiss-Prot	Medium
`Q9LS72`	Arabidopsis thaliana	sp\|Q9LS72\|PP261_ARATH Pentatricopeptide repeat-containing protein At3g29230	47.500%	Swiss-Prot	Medium
`Q9FIF7`	Arabidopsis thaliana	sp\|Q9FIF7\|PP435_ARATH Putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card