TkA08G213200 | RubberDandelionOmics

Gene overview

TkA08G213200

Reference: TK1151 Chr: Chr08 Coordinates: 55780774-55781183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkA08G213200|TK1151|cDNA

ATGCATAAAACTTTGATCTCGTTGGATCAGATGCATCAATCGTATGATAAAATGTTGTGCAAGGCGGAGAAGAGGCTTGAGAAGCTTTATGAGTCGGTTAATGCGGGAAAACAACCGCTTCATGACATCAATCGTATGATAAAACAAATCAAAGGAGCGTATGTACTTCCAATCAAAATGATGAAGAAATCGCTCGATAAACACCACGACGACTCCGCAAACGAAATCTCGTCGTCTTCGAAGATTGACCAGAAATTATG...

CDS

Download CDS FASTA

306 bp · TkA08G213200|TK1151|CDS

ATGCATAAAACTTTGATCTCGTTGGATCAGATGCATCAATCGTATGATAAAATGTTGTGCAAGGCGGAGAAGAGGCTTGAGAAGCTTTATGAGTCGGTTAATGCGGGAAAACAACCGCTTCATGACATCAATCGTATGATAAAACAAATCAAAGGAGCGTATGTACTTCCAATCAAAATGATGAAGAAATCGCTCGATAAACACCACGACGACTCCGCAAACGAAATCTCGTCGTCTTCGAAGATTGACCAGAAATTATG...

Protein

Download Protein FASTA

101 aa · TkA08G213200|TK1151|PROTEIN

MHKTLISLDQMHQSYDKMLCKAEKRLEKLYESVNAGKQPLHDINRMIKQIKGAYVLPIKMMKKSLDKHHDDSANEISSSSKIDQKLCFKITSLTTAISGTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G213200`
TK1151 ID	TkA08G213200
OH-1004 ID	LXL04_032916
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 97.030 / OH-1004 17.235 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G213200`
Location	Chr08:55780774-55781183 (+)
Description	Similar to IMPA9: Importin subunit alpha-9
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032916` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006606 protein import into nucleus Biological Process GO:0006607 NLS-bearing protein import into nucleus Biological Process GO:0006999 nuclear pore organization Biological Process GO:0007127 meiosis I Biological Process GO:0007276 gamete generation Biological Process GO:0007292 female gamete generation Biological Process GO:0009555 pollen development Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0055046 microgametogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component
KEGG gene cross-reference	ath:AT3G11330 ath:AT5G03070 ath:AT5G05850 cel:CELE_F32E10.4 dosa:Os01g0158000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.473

Rank 1 · TkA08G213200 · TK1151

Cytoplasm0.397

Rank 2 · TkA08G213200 · TK1151

Mitochondrion0.096

Rank 3 · TkA08G213200 · TK1151

Cell membrane0.049

Rank 4 · TkA08G213200 · TK1151

Golgi apparatus0.034

Rank 5 · TkA08G213200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28016Mua8-77 aa

PF26039Dcst212-69 aa

PF29562DUF856712-95 aa

PF05064Nsp1_C14-50 aa

PF18644Phage_int_SAM_621-96 aa

PF05064Nsp1_C55-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G213200	`PF28016`	Mua	8	77	0.041	14.8
TkA08G213200	`PF26039`	Dcst2	12	69	0.052	13.4
TkA08G213200	`PF29562`	DUF8567	12	95	0.06	13.9
TkA08G213200	`PF05064`	Nsp1_C	14	50	0.16	12.5
TkA08G213200	`PF18644`	Phage_int_SAM_6	21	96	0.087	13.5
TkA08G213200	`PF05064`	Nsp1_C	55	90	0.16	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card