TkA08G213100 | RubberDandelionOmics

Gene overview

TkA08G213100

Reference: TK1151 Chr: Chr08 Coordinates: 55748941-55752373 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2527 bp · TkA08G213100|TK1151|cDNA

AAATCCCAACAAAGGCGTTGAATAACCTCTTACCTAAAGTTACTCTTCATTTTGAAAGAAGAAAAGTCAAAATTTCGTCCTTTTAGCGATCCCACGCCCTTTCTCCATATGAATATTTAAAGATTTCATGAACCCCAATTCCATAATCAAATCACAGAAGAAAACTAACTACTTCCCGCCATCTTAGCCGTTGGCAAAAAGGGAGCCTTGAGCTTCATTCTCCTAATCTTCATCTCCTTCTTTTAAAAACCTCTATTTCA...

CDS

Download CDS FASTA

783 bp · TkA08G213100|TK1151|CDS

ATGGGTGAAATGATGATCGATAAAATGGGAAATGACAATGACATACCCGTTGTTATAATTCGGCCTAGTGTCATTGAAAGCACTTACAAAGAACCTTTTCCAGGGTGGATGGAAGGAAATAGGATGATGGATCCAATTGTACTTTACTACGGAAAGGGACAACTTAGTGGATTTCTTGTTGACCCTAACGGCGTTCTTGATGTGGTTCCGGCTGATATGGTGGTGAATGCAACAATGGCAGCCATGGCAAAACATGTGAC...

Protein

Download Protein FASTA

260 aa · TkA08G213100|TK1151|PROTEIN

MGEMMIDKMGNDNDIPVVIIRPSVIESTYKEPFPGWMEGNRMMDPIVLYYGKGQLSGFLVDPNGVLDVVPADMVVNATMAAMAKHVTGGKTDDNYIYQIASSAVNPLVFKDLARLLYEHFNSSPCLDLKGRPVHVPIMQLYRSMEEFSAHLWKDAINRSGLNNVGSTNKGKFSHKLENICRKSVEQAKYLANIYEPYTFYGGRFDNSNTQKLMGMMSEEEKRTFGFDVGKIDWRDYISNIHIPGLRRHVMKGRGMCTTHN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G213100`
TK1151 ID	TkA08G213100
OH-1004 ID	LXL04_032909
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 98.077 / OH-1004 28.115 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G213100

Location Chr08:55748941-55752373 (+)

Description Similar to FAR2: Fatty acyl-CoA reductase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11980`	Catalyzes the reduction of fatty acyl-CoA and -ACP (acyl carrier protein) substrates to fatty alcohols.	Biochemical characteristics of AtFAR2, a fatty acid reductase from Arabidopsis thaliana that reduces fatty acyl-CoA and -ACP substrates into fatty alcohols.2016 · DOI: 10.18388/abp.2016_1245
`At3g56700`	Catalyzes the reduction of fatty acyl-CoA and -ACP (acyl carrier protein) substrates to fatty alcohols.	Biochemical characterization of a chloroplast localized fatty acid reductase from Arabidopsis thaliana.2012 · DOI: 10.1016/j.bbalip.2011.10.019
`At3g44560`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Identification of amino acids conferring chain length substrate specificities on fatty alcohol-forming reductases FAR5 and FAR8 from Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m113.499715
`At3g44540`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.2010 · DOI: 10.1104/pp.110.158238 Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822
`At5g22500`	Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.	Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.2010 · DOI: 10.1104/pp.110.158238 Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032909 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0009611 response to wounding Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process

GO:1903175 fatty alcohol biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function

GO:0080019 alcohol-forming very long-chain fatty acyl-CoA reductase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11980

ath:AT3G44540

ath:AT3G44550

ath:AT3G56700

ath:AT5G22500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.303

Rank 1 · TkA08G213100 · TK1151

Peroxisome0.269

Rank 2 · TkA08G213100 · TK1151

Endoplasmic reticulum0.145

Rank 3 · TkA08G213100 · TK1151

Cytoplasm0.105

Rank 4 · TkA08G213100 · TK1151

Mitochondrion0.061

Rank 5 · TkA08G213100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07993NAD_binding_41-78 aa

PF03015Sterile137-153 aa

PF03015Sterile180-251 aa

PF03880DbpA201-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G213100	`PF07993`	NAD_binding_4	1	78	8e-16	58.7
TkA08G213100	`PF03015`	Sterile	137	153	3.3e-18	66.4
TkA08G213100	`PF03015`	Sterile	180	251	3.3e-18	66.4
TkA08G213100	`PF03880`	DbpA	201	243	0.19	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08891`	Arabidopsis thaliana	sp\|Q08891\|FACR2_ARATH Fatty acyl-CoA reductase 2, chloroplastic	69.400%	Swiss-Prot	High
`B9TSP7`	Arabidopsis thaliana	sp\|B9TSP7\|FACR6_ARATH Fatty acyl-CoA reductase 6, chloroplastic	43.500%	Swiss-Prot	Medium
`Q1PEI6`	Arabidopsis thaliana	sp\|Q1PEI6\|FACR8_ARATH Fatty acyl-CoA reductase 8	37.700%	Swiss-Prot	Medium
`Q9LXN3`	Arabidopsis thaliana	sp\|Q9LXN3\|FACR4_ARATH Probable fatty acyl-CoA reductase 4	38.300%	Swiss-Prot	Medium
`Q39152`	Arabidopsis thaliana	sp\|Q39152\|FACR1_ARATH Fatty acyl-CoA reductase 1	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card