Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1098 bp · TkA08G211940|TK1151|cDNA
ATGTTGGAATTGTTTCAATTCCGATGCTTCTGTTTCCGGGGACTCGGCTACTACGACGGTGCAGAAGTCCAGGGGATGGTTTTGTCAGAACAATTAATCTATGCGTCTCTGGCGGCCGAGGATTATGCTCGTAGATTTGAATCTGGGGATATGGTTGAGGGAATCACTAAGGATCTGGCTGCAGATGAACAAGGCCTCTTGAACGCTAAAGTTATGTGCCGCCTCTGTTTCTCAGGTGAAAATGAGGAAATTGAGAGAGC...
1098 bp · TkA08G211940|TK1151|CDS
ATGTTGGAATTGTTTCAATTCCGATGCTTCTGTTTCCGGGGACTCGGCTACTACGACGGTGCAGAAGTCCAGGGGATGGTTTTGTCAGAACAATTAATCTATGCGTCTCTGGCGGCCGAGGATTATGCTCGTAGATTTGAATCTGGGGATATGGTTGAGGGAATCACTAAGGATCTGGCTGCAGATGAACAAGGCCTCTTGAACGCTAAAGTTATGTGCCGCCTCTGTTTCTCAGGTGAAAATGAGGAAATTGAGAGAGC...
Protein
Download Protein FASTA365 aa · TkA08G211940|TK1151|PROTEIN
MLELFQFRCFCFRGLGYYDGAEVQGMVLSEQLIYASLAAEDYARRFESGDMVEGITKDLAADEQGLLNAKVMCRLCFSGENEEIERAKKMLSCKNCNKKYHRTCVKSWAQNRDLFHWSSWTCPSCRTCEVCRRTGDPNKLMYCKRCDGAYHCYCQQPPHKNVSTGPYLCPKHTKCHNCASTVPGNERIQLETSRLYKELIEFHRTLDIFLNSLFSVNEVVKSSVNEVVKSSVNEVGTSSVREVGKSSVIPPQENVPQTTN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G211940 |
|---|---|
| TK1151 ID | TkA08G211940 |
| OH-1004 ID | LXL04_005477 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 95.300 |
| Protein coverage (%) | TK1151 75.890 / OH-1004 62.850Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G211940 |
|---|---|
| Location | Chr08:55455170-55461103 (-) |
| Description | Similar to Kmt2d: Histone-lysine N-methyltransferase 2D |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010468 regulation of gene expression Biological Process GO:0031507 heterochromatin formation Biological Process GO:0032259 methylation Biological Process GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0043627 response to estrogen Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1904837 beta-catenin-TCF complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component |
| KEGG gene cross-reference | hsa:58508 hsa:8085 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16866PHD_470-125 aaPF14446Prok-RING_170-107 aaPF22908PHD_NSD72-123 aaPF00628PHD73-125 aaPF13639zf-RING_273-126 aaPF23004PHDvar_NSD85-107 aaPF16866PHD_4127-178 aaPF22908PHD_NSD127-172 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G211940 | PF16866 | PHD_4 | 70 | 125 | 0.00027 | 21.5 |
| TkA08G211940 | PF14446 | Prok-RING_1 | 70 | 107 | 0.025 | 15.5 |
| TkA08G211940 | PF22908 | PHD_NSD | 72 | 123 | 0.0017 | 19.3 |
| TkA08G211940 | PF00628 | PHD | 73 | 125 | 3e-12 | 47.1 |
| TkA08G211940 | PF13639 | zf-RING_2 | 73 | 126 | 0.02 | 15.9 |
| TkA08G211940 | PF23004 | PHDvar_NSD | 85 | 107 | 3.1e-08 | 34.2 |
| TkA08G211940 | PF16866 | PHD_4 | 127 | 178 | 0.00027 | 21.5 |
| TkA08G211940 | PF22908 | PHD_NSD | 127 | 172 | 0.0017 | 19.3 |
| TkA08G211940 | PF13639 | zf-RING_2 | 127 | 170 | 0.02 | 15.9 |
| TkA08G211940 | PF14446 | Prok-RING_1 | 127 | 155 | 0.025 | 15.5 |
| TkA08G211940 | PF00628 | PHD | 128 | 171 | 3e-12 | 47.1 |
| TkA08G211940 | PF23004 | PHDvar_NSD | 128 | 173 | 3.1e-08 | 34.2 |
| TkA08G211940 | PF00628 | PHD | 172 | 180 | 3e-12 | 47.1 |
| TkA08G211940 | PF14446 | Prok-RING_1 | 172 | 182 | 0.025 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.