TkA08G208120 | RubberDandelionOmics

Gene overview

TkA08G208120

Reference: TK1151 Chr: Chr08 Coordinates: 54358550-54362363 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1442 bp · TkA08G208120|TK1151|cDNA

CCAATTTTACTATTTAATCATGAAAATTATTAATAAATAAGCTCTGAATTTGAGAAATAAGCAATGTAGTGTAGTCACCATTTACCAAGCCTACATGATACATCTCTCTCTCTCTCTCCCTCTCCTGTTCGTTTTTTACACCTTCCACTAGATACAGACACACACACAGCACCAGCCATAGTCGCCATACGTATAACAACCATCTTCATCATCTTCTTCTGCAATAAAACTCCTTTCATTTCAAGTTTCTCTGCTAGATT...

CDS

Download CDS FASTA

693 bp · TkA08G208120|TK1151|CDS

ATGCTGGGCGGACTCATCACAACCACTCTTGTGTTAATTCTTGGATACGCATATCCAGCTTTCGAGTGTTTTAAAACCATCGAGAGACGTGGTACAGAAAACGCAGAATTAAGATTTTGGTGTCAATATTGGGTTCTCATCGCAATAATTACAGTTTTTGAAAGGTTCGCTGATATATTCGTTTCATGGGTACCAATGTATTACGAAGCGAAGTTAGCGCTGATTATCTACTTATGGTATCCAAAAACCAAGGGAACAGA...

Protein

Download Protein FASTA

230 aa · TkA08G208120|TK1151|PROTEIN

MLGGLITTTLVLILGYAYPAFECFKTIERRGTENAELRFWCQYWVLIAIITVFERFADIFVSWVPMYYEAKLALIIYLWYPKTKGTEYVYQTLLRPFLSRHETDIERHLDTMRARAWEVAIHYWNNSSELGQAKLFEIMQYIASQPMRPRSEVSRNVENTREGRPPPSPPPPAVAPTSTEAPQPDQAEDRWIPTAPPMPNISRRHPGNPGELDSPGSPNGSQLNPGTKFE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G208120`
TK1151 ID	TkA08G208120
OH-1004 ID	LXL04_032831
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.130 / OH-1004 94.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G208120

Location Chr08:54358550-54362363 (-)

Description Similar to HVA22I: HVA22-like protein i

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42560`	HVA22-like protein i.	No verified direct reference in this release
`At2g36020`	HVA22-like protein j.	No verified direct reference in this release
`At1g75700`	Putative HVA22-like protein g.	No verified direct reference in this release
`At1g19950`	HVA22-like protein h.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032831 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006998 nuclear envelope organization Biological Process

GO:0007084 mitotic nuclear membrane reassembly Biological Process

GO:0051301 cell division Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005881 cytoplasmic microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G19950

ath:AT1G75700

ath:AT2G36020

ath:AT5G42560

rno:306014

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.631

Rank 1 · TkA08G208120 · TK1151

Nucleus0.188

Rank 2 · TkA08G208120 · TK1151

Cytoplasm0.146

Rank 3 · TkA08G208120 · TK1151

Golgi apparatus0.142

Rank 4 · TkA08G208120 · TK1151

Cell membrane0.058

Rank 5 · TkA08G208120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03134TB2_DP1_HVA2219-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G208120	`PF03134`	TB2_DP1_HVA22	19	97	8.8e-27	93.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE10`	Arabidopsis thaliana	sp\|Q8LE10\|HA22I_ARATH HVA22-like protein i	57.200%	Swiss-Prot	Medium
`Q8GXE9`	Arabidopsis thaliana	sp\|Q8GXE9\|HA22J_ARATH HVA22-like protein j	54.700%	Swiss-Prot	Medium
`Q9LR09`	Arabidopsis thaliana	sp\|Q9LR09\|HA22G_ARATH Putative HVA22-like protein g	49.400%	Swiss-Prot	Medium
`Q8LEM6`	Arabidopsis thaliana	sp\|Q8LEM6\|HA22H_ARATH HVA22-like protein h	47.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card