TkA08G208010 | RubberDandelionOmics

Gene overview

TkA08G208010

Reference: TK1151 Chr: Chr08 Coordinates: 54329058-54329732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkA08G208010|TK1151|cDNA

ATGCAGCTGATACAATTGCGTTTACCGATAAAAGACAGGGCACGTACAAGCGTCTTGTCCAAGTCATGGCTAGATGCTTGGTCGACCATCCCTAACCTCAGATTCCGCGTGTTCCAGAGACACCATTTTGAGGTGGTGGACCGCACCATGTCCAGGTATCTCCAAGACAACATCCCAATCCAAATCCTTGAACTTAACATCAACATCGAGAACATCGAGTCAGCTTTTCTCGCGGAAAAATGGATACGCTCCGTGGCAAC...

CDS

Download CDS FASTA

675 bp · TkA08G208010|TK1151|CDS

ATGCAGCTGATACAATTGCGTTTACCGATAAAAGACAGGGCACGTACAAGCGTCTTGTCCAAGTCATGGCTAGATGCTTGGTCGACCATCCCTAACCTCAGATTCCGCGTGTTCCAGAGACACCATTTTGAGGTGGTGGACCGCACCATGTCCAGGTATCTCCAAGACAACATCCCAATCCAAATCCTTGAACTTAACATCAACATCGAGAACATCGAGTCAGCTTTTCTCGCGGAAAAATGGATACGCTCCGTGGCAAC...

Protein

Download Protein FASTA

224 aa · TkA08G208010|TK1151|PROTEIN

MQLIQLRLPIKDRARTSVLSKSWLDAWSTIPNLRFRVFQRHHFEVVDRTMSRYLQDNIPIQILELNINIENIESAFLAEKWIRSVATKPTEVSLTVALFGASLTVPDEILSACKNLRKLTVASAGQGPVHSLWIKTPIANCVSLRELVLIGVRVSQEVLDAIFSSCRLLENVELRLHKQEGGHGRAIKIKNLARLRELRIYSENGETLIWRSVESQIFGYLDVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G208010`
TK1151 ID	TkA08G208010
OH-1004 ID	LXL04_029104
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.400
Protein coverage (%)	TK1151 91.964 / OH-1004 38.848 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G208010`
Location	Chr08:54329058-54329732 (+)
Description	Similar to At5g03100: F-box protein At5g03100
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029104` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005777 peroxisome Cellular Component
KEGG gene cross-reference	ath:AT3G03040 ath:AT3G18150 ath:AT3G28410 ath:AT3G59230 ath:AT5G03100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.658

Rank 1 · TkA08G208010 · TK1151

Cytoplasm0.316

Rank 2 · TkA08G208010 · TK1151

Cell membrane0.082

Rank 3 · TkA08G208010 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA08G208010 · TK1151

Plastid0.028

Rank 5 · TkA08G208010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box7-32 aa

PF23622LRR_At1g61320_AtMIF159-201 aa

PF24758LRR_At5g5637079-179 aa

PF29594LRR_SKP2104-175 aa

PF00646F-box113-119 aa

PF27799CRISPR-assoc_Csx19170-186 aa

PF27799CRISPR-assoc_Csx19189-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G208010	`PF00646`	F-box	7	32	0.0067	17.0
TkA08G208010	`PF23622`	LRR_At1g61320_AtMIF1	59	201	0.0058	16.8
TkA08G208010	`PF24758`	LRR_At5g56370	79	179	4.5e-07	30.5
TkA08G208010	`PF29594`	LRR_SKP2	104	175	0.094	12.7
TkA08G208010	`PF00646`	F-box	113	119	0.0067	17.0
TkA08G208010	`PF27799`	CRISPR-assoc_Csx19	170	186	0.11	13.2
TkA08G208010	`PF27799`	CRISPR-assoc_Csx19	189	215	0.11	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card