TkA08G207140 | RubberDandelionOmics

Gene overview

TkA08G207140

Reference: TK1151 Chr: Chr08 Coordinates: 54087077-54090951 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2855 bp · TkA08G207140|TK1151|cDNA

CCAATAGAGACTAACCACGTCAACAAGAAAATCCAATATCCACATGGGACGCCACGTGTCAGCAACAAAGTTGGGCTTGAACACAACAAGAAGATACGGGAACCAAACAAATTCTCATCAACCGTTAATTTCTCAGCCAACCCTTTTCCCGAACACACAAGACACGAAACACGGTTTAATCGATACCTGCAAATCCCTCGCCGGAATTCCCTTCGTTTTATTAACAAGATGATAAACTTCAGGCCGTCGGAGACGCGAAC...

CDS

Download CDS FASTA

2580 bp · TkA08G207140|TK1151|CDS

CCAATAGAGACTAACCACGTCAACAAGAAAATCCAATATCCACATGGGACGCCACGTGTCAGCAACAAAGTTGGGCTTGAACACAACAAGAAGATACGGGAACCAAACAAATTCTCATCAACCGTTAATTTCTCAGCCAACCCTTTTCCCGAACACACAAGACACGAAACACGGTTTAATCGATACCTGCAAATCCCTCGCCGGAATTCCCTTCGTTTTATTAACAAGATGATAAACTTCAGGCCGTCGGAGACGCGAAC...

Protein

Download Protein FASTA

859 aa · TkA08G207140|TK1151|PROTEIN

PIETNHVNKKIQYPHGTPRVSNKVGLEHNKKIREPNKFSSTVNFSANPFPEHTRHETRFNRYLQIPRRNSLRFINKMINFRPSETRTSTTSSTVTAERAFSFISKGWREVKDSTEADLQLMKDRANSFKNLASSFDREFENFLTSASRSTFPVAAIANSSSPTPAEIDFVKNLQPKLSEFRRAYSSPDFSKKVLEKWSPRAKIRIDLSAFKNAIVSEVEDVDDRERYRRGPRTTVRDFNWEWKGDGIGDAEEGQLFRNWE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G207140`
TK1151 ID	TkA08G207140
OH-1004 ID	LXL04_026745
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.700
Protein coverage (%)	TK1151 53.667 / OH-1004 90.196 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G207140

Location Chr08:54087077-54090951 (-)

Description Similar to DGD2: Digalactosyldiacylglycerol synthase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11670`	Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes.	Arabidopsis galactolipid biosynthesis and lipid trafficking mediated by DGD1.1999 · DOI: 10.1126/science.284.5423.2181 Disruption of the two digalactosyldiacylglycerol synthase genes DGD1 and DGD2 in Arabidopsis reveals the existence of an additional enzyme of galactolipid synthesis.2003 · DOI: 10.1105/tpc.016675 Decreased stability of photosystem I in dgd1 mutant of Arabidopsis thaliana.2005 · DOI: 10.1016/j.febslet.2005.05.049 Digalactosyl-diacylglycerol deficiency impairs the capacity for photosynthetic intersystem electron transport and state transitions in Arabidopsis thaliana due to photosystem I acceptor-side limitations.2006 · DOI: 10.1093/pcp/pcj089 Phosphate regulation of lipid biosynthesis in Arabidopsis is independent of the mitochondrial outer membrane DGS1 complex.2010 · DOI: 10.1104/pp.110.153262
`At4g00550`	Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes.	DGD2, an arabidopsis gene encoding a UDP-galactose-dependent digalactosyldiacylglycerol synthase is expressed during growth under phosphate-limiting conditions.2002 · DOI: 10.1074/jbc.m110066200 Disruption of the two digalactosyldiacylglycerol synthase genes DGD1 and DGD2 in Arabidopsis reveals the existence of an additional enzyme of galactolipid synthesis.2003 · DOI: 10.1105/tpc.016675 Lipid interacting regions in phosphate stress glycosyltransferase atDGD2 from Arabidopsis thaliana.2011 · DOI: 10.1021/bi200162f

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0009877 nodulation Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035250 UDP-galactosyltransferase activity Molecular Function

GO:0046481 digalactosyldiacylglycerol synthase activity Molecular Function

KEGG gene cross-reference

ath:AT4G00550

gmx:100796354

gmx:547762

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.338

Rank 1 · TkA08G207140 · TK1151

Mitochondrion0.190

Rank 2 · TkA08G207140 · TK1151

Cytoplasm0.167

Rank 3 · TkA08G207140 · TK1151

Endoplasmic reticulum0.132

Rank 4 · TkA08G207140 · TK1151

Nucleus0.128

Rank 5 · TkA08G207140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13524Glyco_trans_1_2524-552 aa

PF00534Glycos_transf_1623-756 aa

PF13692Glyco_trans_1_4623-751 aa

PF13524Glyco_trans_1_2645-751 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G207140	`PF13524`	Glyco_trans_1_2	524	552	6.3e-05	23.7
TkA08G207140	`PF00534`	Glycos_transf_1	623	756	1.6e-13	51.3
TkA08G207140	`PF13692`	Glyco_trans_1_4	623	751	8e-13	49.6
TkA08G207140	`PF13524`	Glyco_trans_1_2	645	751	6.3e-05	23.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7D1`	Arabidopsis thaliana	sp\|Q9S7D1\|DGDG1_ARATH Digalactosyldiacylglycerol synthase 1, chloroplastic	68.300%	Swiss-Prot	High
`Q8W1S1`	Arabidopsis thaliana	sp\|Q8W1S1\|DGDG2_ARATH Digalactosyldiacylglycerol synthase 2, chloroplastic	54.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card