TkA08G206400 | RubberDandelionOmics

Gene overview

TkA08G206400

Reference: TK1151 Chr: Chr08 Coordinates: 53920419-53923857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3135 bp · TkA08G206400|TK1151|cDNA

ATGAAGCTCAACAGAATGATCACATCAAACCCAATATTGTTCATCATCCTACTGGCAATAATCGGCATGCTGCTTCCTACCTTGTTAATCCCAGTTTGGGTGTTAGAGATCAAAGCAATTGAAAAGGAAGTCGATTTAATCACCAAGAAATCTCATGAAGAAACATGGTCTGCCATACAACATGCAGCAACCACATTGCTTCCAATGAAACCATCAGCAACCAATTTAGCCAAACTTGCAAACGAATCTTTGACTAAACC...

CDS

Download CDS FASTA

3135 bp · TkA08G206400|TK1151|CDS

ATGAAGCTCAACAGAATGATCACATCAAACCCAATATTGTTCATCATCCTACTGGCAATAATCGGCATGCTGCTTCCTACCTTGTTAATCCCAGTTTGGGTGTTAGAGATCAAAGCAATTGAAAAGGAAGTCGATTTAATCACCAAGAAATCTCATGAAGAAACATGGTCTGCCATACAACATGCAGCAACCACATTGCTTCCAATGAAACCATCAGCAACCAATTTAGCCAAACTTGCAAACGAATCTTTGACTAAACC...

Protein

Download Protein FASTA

1044 aa · TkA08G206400|TK1151|PROTEIN

MKLNRMITSNPILFIILLAIIGMLLPTLLIPVWVLEIKAIEKEVDLITKKSHEETWSAIQHAATTLLPMKPSATNLAKLANESLTKPDLSFSDIEFKVSPLLFQALITIPHLTQISYIRKDGILFALYSNHHQQIFAIYSNTSFSNLTKSRNNYSWYTQAVDSDTGKLYGDAVVFPSQVLVNETWLQQALNTRNGCVSLGKSFNDVNNSLVLNTAGVDKNGVISLGFDLKSIMDVFSGINPSGGSFYLGTKDGNVMSEVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G206400`
TK1151 ID	TkA08G206400
OH-1004 ID	LXL04_037111
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.300
Protein coverage (%)	TK1151 99.617 / OH-1004 95.059 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G206400

Location Chr08:53920419-53923857 (-)

Description Similar to CKI1: Histidine kinase CKI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47430`	Essential protein.	No verified direct reference in this release
`At2g17820`	Functions as an osmosensor histidine kinase that detects water stress and transmits the stress signal to a downstream MAPK cascade.	Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YA15`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os06g0183200`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037111 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010431 seed maturation Biological Process

GO:0080117 secondary growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G17820

ath:AT2G47430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.407

Rank 1 · TkA08G206400 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA08G206400 · TK1151

Lysosome / Vacuole0.141

Rank 3 · TkA08G206400 · TK1151

Cytoplasm0.128

Rank 4 · TkA08G206400 · TK1151

Golgi apparatus0.121

Rank 5 · TkA08G206400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00512HisKA385-444 aa

PF00512HisKA492-507 aa

PF02518HATPase_c494-527 aa

PF02518HATPase_c568-644 aa

PF00072Response_reg688-717 aa

PF24896Receiver_CRE1904-1033 aa

PF00072Response_reg911-1038 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G206400	`PF00512`	HisKA	385	444	3.6e-06	27.6
TkA08G206400	`PF00512`	HisKA	492	507	3.6e-06	27.6
TkA08G206400	`PF02518`	HATPase_c	494	527	4.5e-22	79.3
TkA08G206400	`PF02518`	HATPase_c	568	644	4.5e-22	79.3
TkA08G206400	`PF00072`	Response_reg	688	717	6.9e-20	72.0
TkA08G206400	`PF24896`	Receiver_CRE1	904	1033	0.00019	22.4
TkA08G206400	`PF00072`	Response_reg	911	1038	6.9e-20	72.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22267`	Arabidopsis thaliana	sp\|O22267\|CKI1_ARATH Histidine kinase CKI1	35.100%	Swiss-Prot	Medium
`Q9SXL4`	Arabidopsis thaliana	sp\|Q9SXL4\|AHK1_ARATH Histidine kinase 1	25.500%	Swiss-Prot	Low
`A2YA15`	Oryza sativa subsp. indica	sp\|A2YA15\|OHK2_ORYSI Probable histidine kinase 2	31.400%	Swiss-Prot	Medium
`Q5SML4`	Oryza sativa subsp. japonica	sp\|Q5SML4\|OHK2_ORYSJ Probable histidine kinase 2	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card