TkA08G206190 | RubberDandelionOmics

Gene overview

TkA08G206190

Reference: TK1151 Chr: Chr08 Coordinates: 53867260-53868278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA08G206190|TK1151|cDNA

ATGGAAGAAATTCGAAGCAGGCTATTCATCGTGCTTCTTTGCTCTCTCTCCGTGATCGTACCTTCAATCTACGCCACAGATTTCAAATACTGCAATAAGTGGAAAGAGTATTCCGTTCAGGTCACTGGAGTCGTCATCAGTCCCTACCCGATAACAAAAGGCGAACTGACCTCCTTCACTATTTCTGCACTCACAGATAAACCATTATCCAGCGGGAAAGTTGTGATCGATGTTGCATACTTTGGATTCCATGTGTATAG...

CDS

Download CDS FASTA

477 bp · TkA08G206190|TK1151|CDS

ATGGAAGAAATTCGAAGCAGGCTATTCATCGTGCTTCTTTGCTCTCTCTCCGTGATCGTACCTTCAATCTACGCCACAGATTTCAAATACTGCAATAAGTGGAAAGAGTATTCCGTTCAGGTCACTGGAGTCGTCATCAGTCCCTACCCGATAACAAAAGGCGAACTGACCTCCTTCACTATTTCTGCACTCACAGATAAACCATTATCCAGCGGGAAAGTTGTGATCGATGTTGCATACTTTGGATTCCATGTGTATAG...

Protein

Download Protein FASTA

158 aa · TkA08G206190|TK1151|PROTEIN

MEEIRSRLFIVLLCSLSVIVPSIYATDFKYCNKWKEYSVQVTGVVISPYPITKGELTSFTISALTDKPLSSGKVVIDVAYFGFHVYSQTGDLCDDTACPISPGDFTVSYSQLLPTIAPPGSYTLTLKMEDDNEKELTCIKFDFSIGFNLKSMRGLAYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G206190`
TK1151 ID	TkA08G206190
OH-1004 ID	LXL04_032809
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G206190`
Location	Chr08:53867260-53868278 (-)
Description	Similar to DDB_G0278295: Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032809` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009651 response to salt stress Biological Process GO:0009958 positive gravitropism Biological Process GO:0015918 sterol transport Biological Process GO:0032366 intracellular sterol transport Biological Process GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0009507 chloroplast Cellular Component GO:0031410 cytoplasmic vesicle Cellular Component GO:0008429 phosphatidylethanolamine binding Molecular Function GO:0032934 sterol binding Molecular Function
KEGG gene cross-reference	aor:AO090026000516 ath:AT2G16005 ddi:DDB_G0278295 ddi:DDB_G0282107 ddi:DDB_G0282179 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.446

Rank 1 · TkA08G206190 · TK1151

Extracellular0.222

Rank 2 · TkA08G206190 · TK1151

Endoplasmic reticulum0.160

Rank 3 · TkA08G206190 · TK1151

Cytoplasm0.151

Rank 4 · TkA08G206190 · TK1151

Cell membrane0.112

Rank 5 · TkA08G206190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14558TRP_N24-144 aa

PF02221E1_DerP2_DerF226-145 aa

PF23623GBD_IRG7_N83-135 aa

PF13750Big_3_3101-133 aa

PF12202OSR1_C124-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G206190	`PF14558`	TRP_N	24	144	0.00018	22.5
TkA08G206190	`PF02221`	E1_DerP2_DerF2	26	145	3.7e-24	86.3
TkA08G206190	`PF23623`	GBD_IRG7_N	83	135	0.045	14.6
TkA08G206190	`PF13750`	Big_3_3	101	133	0.17	12.2
TkA08G206190	`PF12202`	OSR1_C	124	146	0.25	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card