TkA08G206060 | RubberDandelionOmics

Gene overview

TkA08G206060

Reference: TK1151 Chr: Chr08 Coordinates: 53814430-53816684 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1971 bp · TkA08G206060|TK1151|cDNA

CTTTCTTTGTCATCCTACCACCTGTTTTAATTCCATGTTCCTTTTAATTCCCACTCAAACCCTATACAGAGAGAGAGAAACACAGAGAGAGAAGCCATCTTCTAACAAAGACAGTAGCACAATTTTACAAAAACACAACACACATTTTCATCAAATCTAGAGAAGAAAGGGTTCCCAAATCTCAAGATCACCATATCTTCCTCTTCCTCTTCTTCAGGTAATCTGTAAATTTTGATATTTCTCCCACTAAGGCGCCATGG...

CDS

Download CDS FASTA

1365 bp · TkA08G206060|TK1151|CDS

ATGGATTCTCAGATCTATGGTGCATTAAGCCTCATCGTCATCTTCCTCGCCGTTAATGTAAACGCATTGCCGGTACAAACGACCAAATCTAGCTCTACTCAGATTAATTCCAACTCGGTTCTGGTAGCACTTCTCGATTCGCACTACACAGAGCTATCGGAGCTCGTTGAGAAGGCACTTCTTCTACAGACGCTGGAGCAAGCGGTTTCTCATCACAACATCACCATTTTTGCACCCAATAATGAAGCTCTTGAGAGACA...

Protein

Download Protein FASTA

454 aa · TkA08G206060|TK1151|PROTEIN

MDSQIYGALSLIVIFLAVNVNALPVQTTKSSSTQINSNSVLVALLDSHYTELSELVEKALLLQTLEQAVSHHNITIFAPNNEALERQMDPEFKRFLLEPRNLKSLQNLLLYHIIPSRVGSKQWPEEHVIHHQTLCVEESDNRLPLTRGISGEKMVGGLARVVRPDDVIRPDGLIHGIERLLVPRSVQEDFNRRRSLSSISAVLPEGAPVVDPRTHRLKKPATPALAGAPPALPVYDALAPGPSLAPAPAPGPGGPRHHFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G206060`
TK1151 ID	TkA08G206060
OH-1004 ID	LXL04_032805
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 99.559 / OH-1004 89.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G206060

Location Chr08:53814430-53816684 (+)

Description Similar to FLA17: Fasciclin-like arabinogalactan protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06390`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g11700`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g35860`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g52370`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032805 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G35860

ath:AT3G11700

ath:AT3G52370

ath:AT5G06390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.271

Rank 1 · TkA08G206060 · TK1151

Cell membrane0.178

Rank 2 · TkA08G206060 · TK1151

Lysosome / Vacuole0.152

Rank 3 · TkA08G206060 · TK1151

Endoplasmic reticulum0.133

Rank 4 · TkA08G206060 · TK1151

Plastid0.098

Rank 5 · TkA08G206060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469Fasciclin48-183 aa

PF02469Fasciclin297-410 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G206060	`PF02469`	Fasciclin	48	183	7.1e-32	110.9
TkA08G206060	`PF02469`	Fasciclin	297	410	7.1e-32	110.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GR0`	Arabidopsis thaliana	sp\|Q66GR0\|FLA17_ARATH Fasciclin-like arabinogalactan protein 17	73.100%	Swiss-Prot	High
`Q93W32`	Arabidopsis thaliana	sp\|Q93W32\|FLA18_ARATH Fasciclin-like arabinogalactan protein 18	71.400%	Swiss-Prot	High
`Q8RWC5`	Arabidopsis thaliana	sp\|Q8RWC5\|FLA16_ARATH Fasciclin-like arabinogalactan protein 16	71.100%	Swiss-Prot	High
`Q9FT45`	Arabidopsis thaliana	sp\|Q9FT45\|FLA15_ARATH Fasciclin-like arabinogalactan protein 15	69.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card