TkA08G205940 | RubberDandelionOmics

Gene overview

TkA08G205940

Reference: TK1151 Chr: Chr08 Coordinates: 53783468-53785920 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1592 bp · TkA08G205940|TK1151|cDNA

AAAAAAATAAGATGGTGAGGTTGACATGAGACAAAAAAACGCCACAGAACTTGGATCACTGCTTTTCATCGTCCTCTCTCTGTGTTTTTAGGGCTAACAAAACTTAAAAGTCACGAATTTACCGATCAAATTCGCTATCTTAGGTTTCCATTCGTTAGTTATCATCCTCATCTTGTCGAATTCGGTACCCCTGGTTTTAGCGACAAGAACAATCATGGACCGGTTTACTACTTCTCCACGTCTCATGATCGTTTCAGATC...

CDS

Download CDS FASTA

1278 bp · TkA08G205940|TK1151|CDS

ATGGACCGGTTTACTACTTCTCCACGTCTCATGATCGTTTCAGATCTTGATCACACCATGGTTGATCATCATGACCCTGAGAACCTTTCCATACTAAGGTTCAATGCGTTATGGGAGGCTAAATACCGCCATGACTCACTTCTAGTGTTCTCAACAGGAAGATCACCTACACTATACAAACAATTAAGGAAAGAGAAGCCAATATTAACCCCAGACATAACCATAACGTCTGTTGGAACCGAGATAACATATGGTAACAA...

Protein

Download Protein FASTA

425 aa · TkA08G205940|TK1151|PROTEIN

MDRFTTSPRLMIVSDLDHTMVDHHDPENLSILRFNALWEAKYRHDSLLVFSTGRSPTLYKQLRKEKPILTPDITITSVGTEITYGNNMILDEGWVEILNKKWDKKIVSEETSKFPELTMQSETEQRQHKASFFVKKEKAQEVMKSLSERLVNRGLDVKIIYSGGMDLDILPQGAGKGEALAYLHKKLKSEGKLPQNTLACGDSGNDAELFTIPDVHGVMVNNAQEELLQWHSENAKNNPKIIHANERCASGIIEAIGRFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G205940`
TK1151 ID	TkA08G205940
OH-1004 ID	LXL04_012941
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.900
Protein coverage (%)	TK1151 99.765 / OH-1004 99.764 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G205940

Location Chr08:53783468-53785920 (+)

Description Similar to SPP2: Sucrose-phosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35840`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release
`At1g51420`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0143100`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005986 sucrose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0050307 sucrose-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G35840

dosa:Os01g0376700

dosa:Os02g0143100

nta:107767908

nta:107819363

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA08G205940 · TK1151

Nucleus0.315

Rank 2 · TkA08G205940 · TK1151

Mitochondrion0.106

Rank 3 · TkA08G205940 · TK1151

Cell membrane0.086

Rank 4 · TkA08G205940 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA08G205940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05116S6PP9-260 aa

PF08282Hydrolase_312-90 aa

PF08282Hydrolase_383-230 aa

PF02358Trehalose_PPase138-211 aa

PF21141T6PP_C172-209 aa

PF08472S6PP_C283-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G205940	`PF05116`	S6PP	9	260	3.4e-100	335.4
TkA08G205940	`PF08282`	Hydrolase_3	12	90	1.2e-15	58.6
TkA08G205940	`PF08282`	Hydrolase_3	83	230	1.2e-15	58.6
TkA08G205940	`PF02358`	Trehalose_PPase	138	211	0.054	13.3
TkA08G205940	`PF21141`	T6PP_C	172	209	0.23	11.4
TkA08G205940	`PF08472`	S6PP_C	283	412	3.5e-54	182.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ66`	Arabidopsis thaliana	sp\|Q9SJ66\|SPP2_ARATH Probable sucrose-phosphatase 2	66.900%	Swiss-Prot	High
`Q9C8J4`	Arabidopsis thaliana	sp\|Q9C8J4\|SPP1_ARATH Probable sucrose-phosphatase 1	63.200%	Swiss-Prot	High
`Q6YXW6`	Oryza sativa subsp. japonica	sp\|Q6YXW6\|SPP2_ORYSJ Sucrose-phosphatase 2	63.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card