Gene Card
Gene overview
cDNA / CDS / Protein Sequences
594 bp · TkA08G205230|TK1151|cDNA
ATGGAGTCAGATAGCATGCATCCTTCGACCAGTTTCGTCAAATGTTGTGATTGCGGTTGTCGTTCTTGCGATGCGACAACATCTCGATCCTATTCCGGCTCATGGTTACGTTCCGTGAAACGAAAATTAGACGAATACGAAGGAGATGGCGGTAAATTTTTCATACCAGGTCTCCAGATTCACGATGTCGCCCGTGTCGAAATCGAAAACGAATGCGACGTGTTACGCGAAATGGTCAGCAACCAACAACGCACAATCCA...
594 bp · TkA08G205230|TK1151|CDS
ATGGAGTCAGATAGCATGCATCCTTCGACCAGTTTCGTCAAATGTTGTGATTGCGGTTGTCGTTCTTGCGATGCGACAACATCTCGATCCTATTCCGGCTCATGGTTACGTTCCGTGAAACGAAAATTAGACGAATACGAAGGAGATGGCGGTAAATTTTTCATACCAGGTCTCCAGATTCACGATGTCGCCCGTGTCGAAATCGAAAACGAATGCGACGTGTTACGCGAAATGGTCAGCAACCAACAACGCACAATCCA...
Protein
Download Protein FASTA197 aa · TkA08G205230|TK1151|PROTEIN
MESDSMHPSTSFVKCCDCGCRSCDATTSRSYSGSWLRSVKRKLDEYEGDGGKFFIPGLQIHDVARVEIENECDVLREMVSNQQRTIQDLISDLEEERYASSSAANEAMSMILKLQREKAEIQMEARQFKRFSEEKMAHDQQELMALEELLYRREQSIQSLTCEVQAYKHRMISYGLTESEADGDKSFITRENSIATN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G205230 |
|---|---|
| TK1151 ID | TkA08G205230 |
| OH-1004 ID | LXL04_004871 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 62.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 39.876Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G205230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:53631162-53631755 (+) | |||||||||
| Description | Similar to MYOB7: Myosin-binding protein 7 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005811 lipid droplet Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component GO:0030133 transport vesicle Cellular Component GO:0017022 myosin binding Molecular Function GO:0080115 myosin XI tail binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G08800 ath:AT1G70750 ath:AT2G30690 ath:AT5G06560 ath:AT5G16720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25686Betaherpes_U917-26 aaPF25443ANG-166-101 aaPF04102SlyX69-94 aaPF26350DUF809070-117 aaPF19610DUF611570-120 aaPF02601Exonuc_VII_L71-171 aaPF13467RHH_473-102 aaPF04576Zein-binding74-164 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G205230 | PF25686 | Betaherpes_U91 | 7 | 26 | 0.21 | 11.7 |
| TkA08G205230 | PF25443 | ANG-1 | 66 | 101 | 2.9 | 8.8 |
| TkA08G205230 | PF04102 | SlyX | 69 | 94 | 0.011 | 17.0 |
| TkA08G205230 | PF26350 | DUF8090 | 70 | 117 | 0.045 | 14.4 |
| TkA08G205230 | PF19610 | DUF6115 | 70 | 120 | 0.12 | 13.5 |
| TkA08G205230 | PF02601 | Exonuc_VII_L | 71 | 171 | 2.1 | 8.5 |
| TkA08G205230 | PF13467 | RHH_4 | 73 | 102 | 0.12 | 13.2 |
| TkA08G205230 | PF04576 | Zein-binding | 74 | 164 | 4.1e-34 | 117.4 |
| TkA08G205230 | PF25686 | Betaherpes_U91 | 75 | 121 | 0.21 | 11.7 |
| TkA08G205230 | PF26575 | HHO5_N | 76 | 97 | 0.44 | 11.3 |
| TkA08G205230 | PF10679 | DUF2491 | 108 | 169 | 0.088 | 12.7 |
| TkA08G205230 | PF04102 | SlyX | 110 | 120 | 0.011 | 17.0 |
| TkA08G205230 | PF25443 | ANG-1 | 110 | 167 | 2.9 | 8.8 |
| TkA08G205230 | PF18881 | DUF5646 | 117 | 141 | 0.034 | 14.8 |
| TkA08G205230 | PF19610 | DUF6115 | 123 | 184 | 0.12 | 13.5 |
| TkA08G205230 | PF26575 | HHO5_N | 123 | 154 | 0.44 | 11.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.