TkA08G203820 | RubberDandelionOmics

Gene overview

TkA08G203820

Reference: TK1151 Chr: Chr08 Coordinates: 53300815-53301979 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

742 bp · TkA08G203820|TK1151|cDNA

ATGAAATGAGATATTTTTTCAGCTTCACCCCCTTTGCATTTGCCTATATAAAGCACCTACCATCGGTTCAATATCTCATATCATCTTTCGTAAATCAAGTGTTAAACTAATTTCAAACAAAACGATAAGAATGGCCGGAATCATGAGCAAGATCGGAGACGCACTCCACATCGGAGGCGATAAGAAAGACGAGGACAAGAAGCACGAAGGTGCATACTCGTCAGACCACAAGAAAAACGAAGGCGAGCACAAGTCTGACC...

CDS

Download CDS FASTA

312 bp · TkA08G203820|TK1151|CDS

ATGGCCGGAATCATGAGCAAGATCGGAGACGCACTCCACATCGGAGGCGATAAGAAAGACGAGGACAAGAAGCACGAAGGTGCATACTCGTCAGACCACAAGAAAAACGAAGGCGAGCACAAGTCTGACCACAAGCCGGAGAAAAAGGAAGGAGTCGTTGATAAGATCAAGGACAAGATCCACGGCGAAGATGGCGGAAGCAAGGCAGAGTGCGGAGAAGGCGAGAAGAAAAAGAAGAAGGACAAGAAGAAGAAGAAGGA...

Protein

Download Protein FASTA

103 aa · TkA08G203820|TK1151|PROTEIN

MAGIMSKIGDALHIGGDKKDEDKKHEGAYSSDHKKNEGEHKSDHKPEKKEGVVDKIKDKIHGEDGGSKAECGEGEKKKKKDKKKKKEGDHHDGGSSSSSSDSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G203820`
TK1151 ID	TkA08G203820
OH-1004 ID	LXL04_037246
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 73.786 / OH-1004 16.274 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G203820

Location Chr08:53300815-53301979 (+)

Description Similar to ISY1: (S)-8-oxocitronellyl enol synthase ISY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54410`	Intrinsically disordered and metal-binding protein.	A KS-type dehydrin and its related domains reduce Cu-promoted radical generation and the histidine residues contribute to the radical-reducing activities.2013 · DOI: 10.1093/jxb/ert016

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037246 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006720 isoprenoid metabolic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0043693 monoterpene biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Molecular Function

GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function

GO:0035671 enone reductase activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

GO:0047787 Delta4-3-oxosteroid 5beta-reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G24220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.493

Rank 1 · TkA08G203820 · TK1151

Cytoplasm0.487

Rank 2 · TkA08G203820 · TK1151

Nucleus0.253

Rank 3 · TkA08G203820 · TK1151

Extracellular0.045

Rank 4 · TkA08G203820 · TK1151

Mitochondrion0.036

Rank 5 · TkA08G203820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19113DUF57992-28 aa

PF00257Dehydrin3-63 aa

PF15504DUF46477-87 aa

PF05793TFIIF_alpha19-103 aa

PF19113DUF579935-70 aa

PF00257Dehydrin66-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G203820	`PF19113`	DUF5799	2	28	0.53	11.4
TkA08G203820	`PF00257`	Dehydrin	3	63	0.13	13.5
TkA08G203820	`PF15504`	DUF4647	7	87	1.1	8.9
TkA08G203820	`PF05793`	TFIIF_alpha	19	103	1.0	8.6
TkA08G203820	`PF19113`	DUF5799	35	70	0.53	11.4
TkA08G203820	`PF00257`	Dehydrin	66	102	0.13	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLJ2`	Arabidopsis thaliana	sp\|Q9SLJ2\|HRD11_ARATH Dehydrin HIRD11	52.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card