TkA08G202430 | RubberDandelionOmics

Gene overview

TkA08G202430

Reference: TK1151 Chr: Chr08 Coordinates: 52953425-52954062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA08G202430|TK1151|cDNA

CTTTTGGTAGTATCATGTATACTGAATTTTTTCTATGATGGGAAAGATGTTGTGGTACAAAATTTAAGGCAAGCGTGTTTTTATAAAGTGGCCAATGAGACTAAGAAGCCGTGGCTTTGGTGGGATTATGTCGCGGATTTTTCCATAAGGTGTCCTATGAAAGACCAAAAGTACACTAAAGATTGTGCCAATGAGGTTATTAAGTCACTTGGTGTTGACTTGAAGAAAGTGGATGAGTGTGTTGGTGATACAGAAGCGGA...

CDS

Download CDS FASTA

396 bp · TkA08G202430|TK1151|CDS

CTTTTGGTAGTATCATGTATACTGAATTTTTTCTATGATGGGAAAGATGTTGTGGTACAAAATTTAAGGCAAGCGTGTTTTTATAAAGTGGCCAATGAGACTAAGAAGCCGTGGCTTTGGTGGGATTATGTCGCGGATTTTTCCATAAGGTGTCCTATGAAAGACCAAAAGTACACTAAAGATTGTGCCAATGAGGTTATTAAGTCACTTGGTGTTGACTTGAAGAAAGTGGATGAGTGTGTTGGTGATACAGAAGCGGA...

Protein

Download Protein FASTA

132 aa · TkA08G202430|TK1151|PROTEIN

LLVVSCILNFFYDGKDVVVQNLRQACFYKVANETKKPWLWWDYVADFSIRCPMKDQKYTKDCANEVIKSLGVDLKKVDECVGDTEADVDNAVLKAEQEVQIGKGTRGDVTILPTLVINNRQYRGKLAKQAVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G202430`
TK1151 ID	TkA08G202430
OH-1004 ID	LXL04_019351
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 91.667 / OH-1004 19.329 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G202430

Location Chr08:52953425-52954062 (+)

Description Similar to VSR1: Vacuolar-sorting receptor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52850`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	Vacuolar sorting receptor for seed storage proteins in Arabidopsis thaliana.2003 · DOI: 10.1073/pnas.2530568100
`At2g14720`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release
`At2g14740`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release
`At2g30290`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G14720

ath:AT2G14740

ath:AT2G30290

ath:AT3G52850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.444

Rank 1 · TkA08G202430 · TK1151

Lysosome / Vacuole0.226

Rank 2 · TkA08G202430 · TK1151

Endoplasmic reticulum0.183

Rank 3 · TkA08G202430 · TK1151

Cytoplasm0.113

Rank 4 · TkA08G202430 · TK1151

Golgi apparatus0.038

Rank 5 · TkA08G202430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25011VSR_TRX12-132 aa

PF25647SFV1_VP414-77 aa

PF22310NMB0315_dom_I61-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G202430	`PF25011`	VSR_TRX	12	132	3e-53	181.3
TkA08G202430	`PF25647`	SFV1_VP4	14	77	0.093	13.7
TkA08G202430	`PF22310`	NMB0315_dom_I	61	110	0.1	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93026`	Arabidopsis thaliana	sp\|P93026\|VSR1_ARATH Vacuolar-sorting receptor 1	79.300%	Swiss-Prot	High
`Q56ZQ3`	Arabidopsis thaliana	sp\|Q56ZQ3\|VSR4_ARATH Vacuolar-sorting receptor 4	76.000%	Swiss-Prot	High
`O80977`	Arabidopsis thaliana	sp\|O80977\|VSR3_ARATH Vacuolar-sorting receptor 3	75.200%	Swiss-Prot	High
`O22925`	Arabidopsis thaliana	sp\|O22925\|VSR2_ARATH Vacuolar-sorting receptor 2	70.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card