TkA08G199670 | RubberDandelionOmics

Gene overview

TkA08G199670

Reference: TK1151 Chr: Chr08 Coordinates: 52128220-52129576 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA08G199670|TK1151|cDNA

ATGAAAACAGCGAAATTGAGATCTCGCTCAAACAGCACTCGCGACCCTCCTCTCTCAAATCTAAGTAGATCGACCAAACAAACCCCGTCTTCCTCAATTTTCGAGGCTGCTTCCATCGATCTCAATCGCTCCGTGGCGGAGACATCCGATTCTAACTGCGGTGTTAGCGACTCCCATAAACGTGAGTGGCTTTGTAGACTGAAATCATCGTTTAGTATCTCTTTCTGTGGCCTGCAAGAAACGAGAATCGAGTCCCTTCC...

CDS

Download CDS FASTA

903 bp · TkA08G199670|TK1151|CDS

ATGAAAACAGCGAAATTGAGATCTCGCTCAAACAGCACTCGCGACCCTCCTCTCTCAAATCTAAGTAGATCGACCAAACAAACCCCGTCTTCCTCAATTTTCGAGGCTGCTTCCATCGATCTCAATCGCTCCGTGGCGGAGACATCCGATTCTAACTGCGGTGTTAGCGACTCCCATAAACGTGAGTGGCTTTGTAGACTGAAATCATCGTTTAGTATCTCTTTCTGTGGCCTGCAAGAAACGAGAATCGAGTCCCTTCC...

Protein

Download Protein FASTA

300 aa · TkA08G199670|TK1151|PROTEIN

MKTAKLRSRSNSTRDPPLSNLSRSTKQTPSSSIFEAASIDLNRSVAETSDSNCGVSDSHKREWLCRLKSSFSISFCGLQETRIESLPSDIGDWWGDCNLGMEFVPSVGKSGGIISFWDKSLFQAITVIKSRFLLEIVGYWKGLVGETILVNIYAPQANSEKKILWRKLKDLISSRQDHSPIVFRTSLQDFGPRPFRFYNSWLHREDCDQIVNESWGNFHGGGMADRYLSDKLRHLKEALRNWRMVESKKEDKDLVDMKKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G199670`
TK1151 ID	TkA08G199670
OH-1004 ID	LXL04_011938
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.800
Protein coverage (%)	TK1151 78.333 / OH-1004 74.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G199670`
Location	Chr08:52128220-52129576 (+)
Description	Similar to GC6: Golgin candidate 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011938` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007030 Golgi organization Biological Process GO:0007264 small GTPase-mediated signal transduction Biological Process GO:0009791 post-embryonic development Biological Process GO:0032252 secretory granule localization Biological Process GO:0032527 protein exit from endoplasmic reticulum Biological Process GO:0035493 SNARE complex assembly Biological Process GO:0045056 transcytosis Biological Process GO:0048211 Golgi vesicle docking Biological Process GO:0048280 vesicle fusion with Golgi apparatus Biological Process GO:0061025 membrane fusion Biological Process
KEGG gene cross-reference	ath:AT3G27530 mmu:56041 sce:YDL058W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.546

Rank 1 · TkA08G199670 · TK1151

Nucleus0.451

Rank 2 · TkA08G199670 · TK1151

Plastid0.067

Rank 3 · TkA08G199670 · TK1151

Cell membrane0.067

Rank 4 · TkA08G199670 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA08G199670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18824LPD11223-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G199670	`PF18824`	LPD11	223	282	0.2	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card