TkA08G195280 | RubberDandelionOmics

Gene overview

TkA08G195280

Reference: TK1151 Chr: Chr08 Coordinates: 51002541-51003319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

706 bp · TkA08G195280|TK1151|cDNA

AATCAATTAAAAATAACGAAGTAATGATCGTCTTGTGCTCTTTTTGTAGAAATCGATGTTGCATTCTGAATGCGAGAAAGAGATTTTGGAGATACGGAAGAAATACGATGCGTTAATCGACGAATCTGAGATTTGTTTGACGAAAGAGATGAATGTTCTTCAACAGTATTACGATCTTGTATACGCTAACAAAATTCTGGCCGATACTTTCACACAAGCGTGTGACGTTACTCTCAATGAAGAAAAATCACTGAAAGAAA...

CDS

Download CDS FASTA

498 bp · TkA08G195280|TK1151|CDS

ATGTTGCATTCTGAATGCGAGAAAGAGATTTTGGAGATACGGAAGAAATACGATGCGTTAATCGACGAATCTGAGATTTGTTTGACGAAAGAGATGAATGTTCTTCAACAGTATTACGATCTTGTATACGCTAACAAAATTCTGGCCGATACTTTCACACAAGCGTGTGACGTTACTCTCAATGAAGAAAAATCACTGAAAGAAAGCGGTGGTTTGAGAGTTGCGGAAATCCCTGCATCTCAACTTGTACAATCAAGGAA...

Protein

Download Protein FASTA

165 aa · TkA08G195280|TK1151|PROTEIN

MLHSECEKEILEIRKKYDALIDESEICLTKEMNVLQQYYDLVYANKILADTFTQACDVTLNEEKSLKESGGLRVAEIPASQLVQSRNRCTSTNSMPTLRAPAPHLRSSSTLIPQTPKDMKNVDYQENSEKLSVVQSSPSELLEEYYSFYDMGFPNLPFLESNSGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G195280`
TK1151 ID	TkA08G195280
OH-1004 ID	LXL04_032669
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.400
Protein coverage (%)	TK1151 100.000 / OH-1004 22.356 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G195280`
Location	Chr08:51002541-51003319 (+)
Description	Similar to MOM1: Helicase protein MOM1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032669` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007051 spindle organization Biological Process GO:0007098 centrosome cycle Biological Process GO:0010468 regulation of gene expression Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0031507 heterochromatin formation Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process
KEGG gene cross-reference	ath:AT1G08060 ath:AT5G44800 hsa:1107 hsa:6594 mmu:93761 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.550

Rank 1 · TkA08G195280 · TK1151

Cytoplasm0.456

Rank 2 · TkA08G195280 · TK1151

Mitochondrion0.048

Rank 3 · TkA08G195280 · TK1151

Cell membrane0.040

Rank 4 · TkA08G195280 · TK1151

Golgi apparatus0.031

Rank 5 · TkA08G195280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21718KH_DTX3L2-34 aa

PF26081DUF80316-29 aa

PF06920DHR-2_Lobe_A21-91 aa

PF22727NCH229-68 aa

PF21718KH_DTX3L117-131 aa

PF26081DUF8031127-139 aa

PF22727NCH2137-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G195280	`PF21718`	KH_DTX3L	2	34	0.28	11.7
TkA08G195280	`PF26081`	DUF8031	6	29	0.12	13.0
TkA08G195280	`PF06920`	DHR-2_Lobe_A	21	91	0.052	14.6
TkA08G195280	`PF22727`	NCH2	29	68	0.058	14.2
TkA08G195280	`PF21718`	KH_DTX3L	117	131	0.28	11.7
TkA08G195280	`PF26081`	DUF8031	127	139	0.12	13.0
TkA08G195280	`PF22727`	NCH2	137	147	0.058	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card