TkA08G193690 | RubberDandelionOmics

Gene overview

TkA08G193690

Reference: TK1151 Chr: Chr08 Coordinates: 50605114-50608446 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2189 bp · TkA08G193690|TK1151|cDNA

CCTACATTCCTCATCCCAGGTGCTCCATGTGACCTAATGGGCTACAAAACGGTTTAATTGCATCCAACAAATCAAACGTGTTTGTGTCTCATAGAAAATGATTTGAAACCAACTTTCTTCCGTATATATATGAAATTTGTCCTTAGCAATTAATTGTTACAAATAAAAAAATGTACATATATATGAAAAACATTAAGAAAATACGAAAAATACACGCCGTCAGGCAGGGCCATTGTGGGTGTAAGCAAACGTGTTCTGAC...

CDS

Download CDS FASTA

1044 bp · TkA08G193690|TK1151|CDS

ATGTGCGAACCAGATTCAGATGTTGTGAAATGGGGTCTTAACATCCTCGATGTCGATCAAATCTTTAGTTCTACTTATTACGGCGATAGCAATCAACACGACGTCAGCATCTCTCACGAACAGTACAACAATGGCGGCACTTACCAAGAGAACGAATTCAACAACAATGTCGAAAACGACGAATTGCTGGCTCACTCTCTTCAACACGAACTATTAGATCTCTCAATTACAGACCGAAACGAATTATCCAATCCAGATGA...

Protein

Download Protein FASTA

347 aa · TkA08G193690|TK1151|PROTEIN

MCEPDSDVVKWGLNILDVDQIFSSTYYGDSNQHDVSISHEQYNNGGTYQENEFNNNVENDELLAHSLQHELLDLSITDRNELSNPDEYLQTSNDVQDWYSPSPDNHYYGDESRVQETEEMGHSSSCSSPGNRSYDGDEYSYNLEITDESELDGEVGKRLNEIVPVPHIPKVNGDIPSVDEATSDHQRLLDRLQLYNLVESKVQGDGNCQFRALSDQFYRSPEHHKFVRRQVVNQLKSHPEMYEGYVPMAYSDYLKRISKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G193690`
TK1151 ID	TkA08G193690
OH-1004 ID	LXL04_032652
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G193690

Location Chr08:50605114-50608446 (-)

Description Similar to OTU9: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04250`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable).	No verified direct reference in this release
`At5g03330`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable).	No verified direct reference in this release
`At3g02070`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable).	No verified direct reference in this release
`At3g22260`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02070

ath:AT3G22260

ath:AT5G03330

ath:AT5G04250

ddi:DDB_G0284757

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.521

Rank 1 · TkA08G193690 · TK1151

Nucleus0.504

Rank 2 · TkA08G193690 · TK1151

Cell membrane0.094

Rank 3 · TkA08G193690 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA08G193690 · TK1151

Lysosome / Vacuole0.052

Rank 5 · TkA08G193690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29258OTU_Vertnin40-58 aa

PF02338OTU61-95 aa

PF29258OTU_Vertnin201-244 aa

PF10275Peptidase_C65201-213 aa

PF02338OTU203-290 aa

PF10275Peptidase_C65226-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G193690	`PF29258`	OTU_Vertnin	40	58	0.00099	19.9
TkA08G193690	`PF02338`	OTU	61	95	1e-12	49.4
TkA08G193690	`PF29258`	OTU_Vertnin	201	244	0.00099	19.9
TkA08G193690	`PF10275`	Peptidase_C65	201	213	0.0031	17.7
TkA08G193690	`PF02338`	OTU	203	290	1e-12	49.4
TkA08G193690	`PF10275`	Peptidase_C65	226	318	0.0031	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBW2`	Arabidopsis thaliana	sp\|Q8LBW2\|OTU9_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 9	49.700%	Swiss-Prot	Medium
`Q9LZF7`	Arabidopsis thaliana	sp\|Q9LZF7\|OTU10_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 10	50.700%	Swiss-Prot	High
`Q9SGA5`	Arabidopsis thaliana	sp\|Q9SGA5\|OTU12_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 12	56.200%	Swiss-Prot	Medium
`Q0V869`	Arabidopsis thaliana	sp\|Q0V869\|OTU11_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 11	51.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card