TkA08G192280 | RubberDandelionOmics

Gene overview

TkA08G192280

Reference: TK1151 Chr: Chr08 Coordinates: 50249008-50256084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2685 bp · TkA08G192280|TK1151|cDNA

CTTCACAGAACGAGTCACTCGCGTATCCCCTTCACATCCGCACCTATAAATTCACACAACTTCCCCACTCATCACTTGAACCATCCATCTCTCTCGCTCTATCGTTCTGCCTCATATCTCTCTCTCTCTGAAGATCCCGATCGAAGAAAGAGATGGAAACTTTCCTATTCACATCAGAATCCGTCAACGAAGGTCACCCAGACAAGCTCTGCGACCAAGTTTCCGACGCCATCCTCGACGCATGTCTAGAACAAGACCCC...

CDS

Download CDS FASTA

1173 bp · TkA08G192280|TK1151|CDS

ATGGAAACTTTCCTATTCACATCAGAATCCGTCAACGAAGGTCACCCAGACAAGCTCTGCGACCAAGTTTCCGACGCCATCCTCGACGCATGTCTAGAACAAGACCCCGAAAGCAAAGTCGCCTGTGAAACCTGCACCAAAACCAACATGGTGATGGTGTTCGGCGAAATCACCACCAAAGCCAAAATCGACTACGAGAAAATCGTCCGTACAACCTGCAAAGAAATCGGATTCACATCTCCCGACGTCGGACTCGATGC...

Protein

Download Protein FASTA

390 aa · TkA08G192280|TK1151|PROTEIN

METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKIDYEKIVRTTCKEIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCSWLRPDGKTQVTVEYKNDNGAMVPIRVHTVLISTQHDETVTNDQIAKDLKEHVIKPVIPSKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G192280`
TK1151 ID	TkA08G192280
OH-1004 ID	LXL04_032635
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G192280`
Location	Chr08:50249008-50256084 (-)
Description	Similar to SAMS2: S-adenosylmethionine synthase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032635` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006556 S-adenosylmethionine biosynthetic process Biological Process GO:0006730 one-carbon metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004478 methionine adenosyltransferase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	nta:107785513 nta:107807060 sly:544302 sot:102578902 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.746

Rank 1 · TkA08G192280 · TK1151

Nucleus0.228

Rank 2 · TkA08G192280 · TK1151

Mitochondrion0.131

Rank 3 · TkA08G192280 · TK1151

Cell membrane0.089

Rank 4 · TkA08G192280 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA08G192280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00438S-AdoMet_synt_N4-101 aa

PF02772S-AdoMet_synt_M32-95 aa

PF15540Ntox4768-105 aa

PF02772S-AdoMet_synt_M117-238 aa

PF15540Ntox47157-199 aa

PF02773S-AdoMet_synt_C190-213 aa

PF02773S-AdoMet_synt_C240-381 aa

PF00438S-AdoMet_synt_N293-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G192280	`PF00438`	S-AdoMet_synt_N	4	101	4.4e-44	149.8
TkA08G192280	`PF02772`	S-AdoMet_synt_M	32	95	2.2e-48	164.0
TkA08G192280	`PF15540`	Ntox47	68	105	0.055	14.4
TkA08G192280	`PF02772`	S-AdoMet_synt_M	117	238	2.2e-48	164.0
TkA08G192280	`PF15540`	Ntox47	157	199	0.055	14.4
TkA08G192280	`PF02773`	S-AdoMet_synt_C	190	213	2.7e-61	206.2
TkA08G192280	`PF02773`	S-AdoMet_synt_C	240	381	2.7e-61	206.2
TkA08G192280	`PF00438`	S-AdoMet_synt_N	293	308	4.4e-44	149.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card