TkA08G191400 | RubberDandelionOmics

Gene overview

TkA08G191400

Reference: TK1151 Chr: Chr08 Coordinates: 49989524-49996526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1761 bp · TkA08G191400|TK1151|cDNA

AGAGAACCTACAAAACTCCCTTCCGAAACGCCAATGGCTTCCCTTCCCAGCGACCTTCACTTTGTGTTGTTTCCATTAATGGCTCAAGGCCAATTACTAATCCTATGATATAGCCCAGAGACCCGATTACTAGCCCAAAGAGGCGCACAGTCACCATCATCACTACTCCTGTTAACGCCAACCGTTTCAAATCGGTCATCACTCGGGCAATCGAAGATAAGCTCAAGATTCAAGTTCTTGAATTCCCACTCCAATTAACT...

CDS

Download CDS FASTA

1269 bp · TkA08G191400|TK1151|CDS

ATGCTTCCATCTGCTTCCCTCTATCCCCAATTGTTTCAAGCTGCGGATTTGTTAGAGGAACCGGTAGATAACAAGCTCCGGCAACTAACTCCGGCTCCAAGTTGCATCATTTCTGATAATCTTTTTCCTTGGACTAATGATATTGCTAGGAAGCTCGATATTCCGAGGCTTATATTCCATGGTCCTGGATGCTTCACATTTTTGTGCATACACATACTGATGAATACTAATATACTCAATGAAATGGTCTCCGATTCAGA...

Protein

Download Protein FASTA

422 aa · TkA08G191400|TK1151|PROTEIN

MLPSASLYPQLFQAADLLEEPVDNKLRQLTPAPSCIISDNLFPWTNDIARKLDIPRLIFHGPGCFTFLCIHILMNTNILNEMVSDSEYFVLPGISDRIEITKAQGLSWGNRDNEQMAKMFERVKIAEEAANGIVVNSFQEIERHYVEELAKAKDKKVWCIGPVSLCNKSFDDLAERGSKAGINEHDCLKWLNSREEESVIFVCLGSISRTCTEQSIELALGLESSNIPFIWCVRHSTEELDKWFLEEGYEERVKDRGLIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G191400`
TK1151 ID	TkA08G191400
OH-1004 ID	LXL04_032616
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 95.498 / OH-1004 77.842 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G191400

Location Chr08:49989524-49996526 (+)

Description Similar to UGT73E1: UDP-glycosyltransferase 73E1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36780`	UDP-glycosyltransferase 73C3.	No verified direct reference in this release
`At2g36760`	UDP-glycosyltransferase 73C2.	No verified direct reference in this release
`At2g36770`	UDP-glycosyltransferase 73C4.	No verified direct reference in this release
`At2g36800`	Specifically catalyzes 23-O-glucosylation of brassinosteroids, resulting probably in their inactivation.	Detoxification of the Fusarium mycotoxin deoxynivalenol by a UDP-glucosyltransferase from Arabidopsis thaliana.2003 · DOI: 10.1074/jbc.m307552200 N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200 The UGT73C5 of Arabidopsis thaliana glucosylates brassinosteroids.2005 · DOI: 10.1073/pnas.0504279102

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032616 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0016134 saponin metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0046527 glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AFN26667

ath:AT2G36770

ath:AT2G36780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.787

Rank 1 · TkA08G191400 · TK1151

Nucleus0.223

Rank 2 · TkA08G191400 · TK1151

Peroxisome0.069

Rank 3 · TkA08G191400 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA08G191400 · TK1151

Plastid0.048

Rank 5 · TkA08G191400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N124-163 aa

PF00201UDPGT187-315 aa

PF06722EryCIII-like_C275-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G191400	`PF26168`	Glyco_transf_N	124	163	0.0008	20.1
TkA08G191400	`PF00201`	UDPGT	187	315	1.4e-19	71.1
TkA08G191400	`PF06722`	EryCIII-like_C	275	315	0.014	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ96`	Arabidopsis thaliana	sp\|Q9ZQ96\|U73C3_ARATH UDP-glycosyltransferase 73C3	53.100%	Swiss-Prot	High
`Q9ZQ98`	Arabidopsis thaliana	sp\|Q9ZQ98\|U73C2_ARATH UDP-glycosyltransferase 73C2	50.000%	Swiss-Prot	High
`Q9ZQ97`	Arabidopsis thaliana	sp\|Q9ZQ97\|U73C4_ARATH UDP-glycosyltransferase 73C4	50.200%	Swiss-Prot	High
`Q9ZQ94`	Arabidopsis thaliana	sp\|Q9ZQ94\|U73C5_ARATH UDP-glycosyltransferase 73C5	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card