TkA08G190680 | RubberDandelionOmics

Gene overview

TkA08G190680

Reference: TK1151 Chr: Chr08 Coordinates: 49835358-49837127 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1417 bp · TkA08G190680|TK1151|cDNA

TCTTAATCGCAATCCTTTAATCCAAAAACATGAACACCAAAAGAACCATATTCTTTTGGCTATCAGTCATCACCATTGCTCTTATTTCCATAATAATCTCTTTCTACAACTCAACCATAACTACTACCATCGTCTCTTTACCTGGCTTTCAAGTCGCTTTTATCAAAAGGGTCTTTGAGAAAAGTGGAATTTATGAGTTAGTCTCTTTCATAACCCAAATTTCCGGTCACCACCACCGCCTTCACGACCAGAAGGCTACC...

CDS

Download CDS FASTA

1209 bp · TkA08G190680|TK1151|CDS

ATGAACACCAAAAGAACCATATTCTTTTGGCTATCAGTCATCACCATTGCTCTTATTTCCATAATAATCTCTTTCTACAACTCAACCATAACTACTACCATCGTCTCTTTACCTGGCTTTCAAGTCGCTTTTATCAAAAGGGTCTTTGAGAAAAGTGGAATTTATGAGTTAGTCTCTTTCATAACCCAAATTTCCGGTCACCACCACCGCCTTCACGACCAGAAGGCTACCTGTTCCAACAAGTGGAGCTCAAGTCTTGT...

Protein

Download Protein FASTA

402 aa · TkA08G190680|TK1151|PROTEIN

MNTKRTIFFWLSVITIALISIIISFYNSTITTTIVSLPGFQVAFIKRVFEKSGIYELVSFITQISGHHHRLHDQKATCSNKWSSSLVSEYRVSLILTVDQNGCGNFTSLQEAVDAVPDSSSSSTLIILDSGTYREKVTVNENKTNLIIQGQGYLNTEITWNDTANSTGGTIYSSTISIFAQKFTAYNISFKNTAPPPILGAVGAQALALRIAGDQAAFYGCGFYGAQDTLHDDRGRHYFKKCFIEGSIDFVFGNGRSLYE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G190680`
TK1151 ID	TkA08G190680
OH-1004 ID	LXL04_032603
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G190680

Location Chr08:49835358-49837127 (+)

Description Similar to PME15: Probable pectinesterase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36710`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g36700`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At1g05310`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g19730`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g47500`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032603 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0030599 pectinesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05310

ath:AT2G36700

ath:AT2G36710

ath:AT5G19730

ath:AT5G47500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.281

Rank 1 · TkA08G190680 · TK1151

Extracellular0.222

Rank 2 · TkA08G190680 · TK1151

Cell membrane0.143

Rank 3 · TkA08G190680 · TK1151

Endoplasmic reticulum0.142

Rank 4 · TkA08G190680 · TK1151

Cytoplasm0.115

Rank 5 · TkA08G190680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05656DUF8055-75 aa

PF01095Pectinesterase97-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G190680	`PF05656`	DUF805	5	75	0.096	13.9
TkA08G190680	`PF01095`	Pectinesterase	97	390	1.4e-67	228.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQA3`	Arabidopsis thaliana	sp\|Q9ZQA3\|PME15_ARATH Probable pectinesterase 15	63.000%	Swiss-Prot	High
`Q9ZQA4`	Arabidopsis thaliana	sp\|Q9ZQA4\|PME14_ARATH Putative pectinesterase 14	60.000%	Swiss-Prot	High
`O23038`	Arabidopsis thaliana	sp\|O23038\|PME8_ARATH Probable pectinesterase 8	55.100%	Swiss-Prot	High
`Q8VYZ3`	Arabidopsis thaliana	sp\|Q8VYZ3\|PME53_ARATH Probable pectinesterase 53	47.600%	Swiss-Prot	Medium
`Q8LPF3`	Arabidopsis thaliana	sp\|Q8LPF3\|PME68_ARATH Probable pectinesterase 68	47.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card