TkA08G190020 | RubberDandelionOmics

Gene overview

TkA08G190020

Reference: TK1151 Chr: Chr08 Coordinates: 49632515-49635761 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2062 bp · TkA08G190020|TK1151|cDNA

ATTCCCTTGGGTGCGAAGTGAAATATTTACCCTTGGCATTTCTTCTTTCAAACTGGACTCGCACACCGAAAGAACAGAAGTAGAAAGAGCGAAGAAAACGATCTAGCAAGCCATCGCCGGATCTCCTCCTATCGTAGCGACCAACTTATAGGGGTGCTCAAATATCTCACTTGAATTAGTCGCCATTGAACTTCGCTACTCTCTAAAATGGTTGTTCTAGCAGCCTCCATCATCAGTAAATCTGGCAAAGCACTTGTTTC...

CDS

Download CDS FASTA

669 bp · TkA08G190020|TK1151|CDS

ATGGTTGTTCTAGCAGCCTCCATCATCAGTAAATCTGGCAAAGCACTTGTTTCAAGGCAGTTTGTTGACATGTCTCGCATCAGAATTGAGGGGCTTCTTGCAGCTTTCCCTAAGTTGGTTGGAACTGGGAAACAACACACCTATGTTGAGACAGAAAATGTGCGCTATGTCTACCAGCCAATTGAGAGCTTATATCTGCTACTTGTCACAAACAAACAAAGCAACATCCTTGAGGACATTGACACACTCAGGCTTCTTTC...

Protein

Download Protein FASTA

222 aa · TkA08G190020|TK1151|PROTEIN

MVVLAASIISKSGKALVSRQFVDMSRIRIEGLLAAFPKLVGTGKQHTYVETENVRYVYQPIESLYLLLVTNKQSNILEDIDTLRLLSKIIPEYSSSLDEEGICKYAFELIFAFDEVISLGHKENVTVAQVKQYIEMESHEERLHNLVLQSKINETKDVMKRKANEIDKSKIERGKLDKGGFHLYNHQWAQSEEWTVDSVTTCQWGYQVGTLTTTLEVVLDSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G190020`
TK1151 ID	TkA08G190020
OH-1004 ID	LXL04_032591
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 81.532 / OH-1004 33.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G190020

Location Chr08:49632515-49635761 (-)

Description Similar to Os05g0311000: Coatomer subunit delta-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05010`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0310800`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os05g0311000`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release
`Os01g0833700`	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032591 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0015031 protein transport Biological Process

GO:0043473 pigmentation Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0051645 Golgi localization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005798 Golgi-associated vesicle Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT5G05010

dosa:Os01g0833700

dosa:Os05g0310800

dosa:Os05g0311000

mmu:213827

osa:4327409

osa:4338376

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.522

Rank 1 · TkA08G190020 · TK1151

Cytoplasm0.504

Rank 2 · TkA08G190020 · TK1151

Cell membrane0.129

Rank 3 · TkA08G190020 · TK1151

Endoplasmic reticulum0.115

Rank 4 · TkA08G190020 · TK1151

Nucleus0.115

Rank 5 · TkA08G190020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01217Clat_adaptor_s8-136 aa

PF06156YabA121-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G190020	`PF01217`	Clat_adaptor_s	8	136	2.3e-05	25.1
TkA08G190020	`PF06156`	YabA	121	192	0.1	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y22`	Arabidopsis thaliana	sp\|Q93Y22\|COPD_ARATH Coatomer subunit delta	81.800%	Swiss-Prot	High
`Q0DJA0`	Oryza sativa subsp. japonica	sp\|Q0DJA0\|COPD1_ORYSJ Coatomer subunit delta-1	86.200%	Swiss-Prot	High
`Q0DJ99`	Oryza sativa subsp. japonica	sp\|Q0DJ99\|COPD2_ORYSJ Coatomer subunit delta-2	86.200%	Swiss-Prot	High
`P49661`	Oryza sativa subsp. japonica	sp\|P49661\|COPD3_ORYSJ Coatomer subunit delta-3	86.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card