TkA08G189510 | RubberDandelionOmics

Gene overview

TkA08G189510

Reference: TK1151 Chr: Chr08 Coordinates: 49518195-49520062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

880 bp · TkA08G189510|TK1151|cDNA

CAGAAGTCGAACTTGGCAATTGGCATATTCCTCTCTTATTTTACCAAATTCCCATCTGATTCACGCTTCATTCTCATCTCCATACGTCCTTCTCTTTCATTCTGTAAACCCTTCTCTCGATTTCGACTTCTAAGATTTGTTGCTGTTAATCAGTCAAAATGCACTCCAATCACTTGCTTCTCGAAGAGCCTATCAGAATGACATCCATCCTCGAGCCTGCTAAAGATAGTTTCTTCCCTGCGATGACCAAAATCGTTGGG...

CDS

Download CDS FASTA

498 bp · TkA08G189510|TK1151|CDS

ATGCACTCCAATCACTTGCTTCTCGAAGAGCCTATCAGAATGACATCCATCCTCGAGCCTGCTAAAGATAGTTTCTTCCCTGCGATGACCAAAATCGTTGGGACTTTGGGACCTCGCTCACGATCTGTGGAGGTTATCTTGGTTGCCTCAAAGCTGGCATGTCTGTTGCAAGATTTGATTTCTCATGGGGAGAGCTCTGCATATCACCAAGAAACTTTGGATAATCTAAAGTCTGCTATCAAGAGCACTAAGAAGCTTTG...

Protein

Download Protein FASTA

165 aa · TkA08G189510|TK1151|PROTEIN

MHSNHLLLEEPIRMTSILEPAKDSFFPAMTKIVGTLGPRSRSVEVILVASKLACLLQDLISHGESSAYHQETLDNLKSAIKSTKKLCAVMLDTVGAEMQGVNKSEKSISLQQDDNVILTLTKARKLLLKYTNHFNGLAKAVKKGDTISLVSTCSQEVKQPLLAGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G189510`
TK1151 ID	TkA08G189510
OH-1004 ID	LXL04_032584
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 89.091 / OH-1004 28.083 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G189510

Location Chr08:49518195-49520062 (+)

Description Similar to Os12g0145700: Pyruvate kinase 2, cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BM17`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`Os12g0145700`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`UniProt: B8BJ39`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release
`Os11g0148500`	Key regulatory enzyme of the glycolytic pathway that catalyzes the final step of glycolysis, converting ADP and phosphoenolpyruvate (PEP) to ATP and pyruvate by essentially irreversible transphosphorylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006950 response to stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004743 pyruvate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0030955 potassium ion binding Molecular Function

KEGG gene cross-reference

dosa:Os11g0148500

dosa:Os12g0145700

gmx:547791

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568

Rank 1 · TkA08G189510 · TK1151

Nucleus0.329

Rank 2 · TkA08G189510 · TK1151

Cell membrane0.108

Rank 3 · TkA08G189510 · TK1151

Mitochondrion0.107

Rank 4 · TkA08G189510 · TK1151

Golgi apparatus0.079

Rank 5 · TkA08G189510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00224PK30-147 aa

PF20867UVSSA_N50-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G189510	`PF00224`	PK	30	147	1.4e-13	51.4
TkA08G189510	`PF20867`	UVSSA_N	50	138	0.12	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B8BM17`	Oryza sativa subsp. indica	sp\|B8BM17\|KPYC2_ORYSI Pyruvate kinase 2, cytosolic	62.200%	Swiss-Prot	High
`Q2QXR8`	Oryza sativa subsp. japonica	sp\|Q2QXR8\|KPYC2_ORYSJ Pyruvate kinase 2, cytosolic	62.200%	Swiss-Prot	High
`B8BJ39`	Oryza sativa subsp. indica	sp\|B8BJ39\|KPYC1_ORYSI Pyruvate kinase 1, cytosolic	58.800%	Swiss-Prot	High
`Q2RAK2`	Oryza sativa subsp. japonica	sp\|Q2RAK2\|KPYC1_ORYSJ Pyruvate kinase 1, cytosolic	58.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card