TkA08G187590 | RubberDandelionOmics

Gene overview

TkA08G187590

Reference: TK1151 Chr: Chr08 Coordinates: 48982039-48986609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1398 bp · TkA08G187590|TK1151|cDNA

ATGCTTTCGTGCGGGGGTCGGTTGACCCTTCTCAAATCGGTGTTGGGGTCTCTTGACCCTACGGCTATTTGGGTGAAGGTTATTAAGGCGTGTCATGGGTCTCATGCGGGTTTTGTGCCAAATCATAGAGTTATCGGTGGAGGAGTTTGGAAGGGAATTACCGACACAATTACTAAGCTTTATATGGATGAAGCCATTCAGTCGGCCTCCCTTTATAAGGATGGTGGTTGGCATCTTCAATGGCGTTCCACTTTGAGGGG...

CDS

Download CDS FASTA

1398 bp · TkA08G187590|TK1151|CDS

ATGCTTTCGTGCGGGGGTCGGTTGACCCTTCTCAAATCGGTGTTGGGGTCTCTTGACCCTACGGCTATTTGGGTGAAGGTTATTAAGGCGTGTCATGGGTCTCATGCGGGTTTTGTGCCAAATCATAGAGTTATCGGTGGAGGAGTTTGGAAGGGAATTACCGACACAATTACTAAGCTTTATATGGATGAAGCCATTCAGTCGGCCTCCCTTTATAAGGATGGTGGTTGGCATCTTCAATGGCGTTCCACTTTGAGGGG...

Protein

Download Protein FASTA

465 aa · TkA08G187590|TK1151|PROTEIN

MLSCGGRLTLLKSVLGSLDPTAIWVKVIKACHGSHAGFVPNHRVIGGGVWKGITDTITKLYMDEAIQSASLYKDGGWHLQWRSTLRGGAQLSQLQELLEMLEDRRCSGDPDSWGWGLDASGIFLVKSLQQHIDAVTLPVVASLTQWVRDVPIKVGILVWRLGLHRLPTLDNLDRRGVDVPSVLCPCCQDGIESTNHVFFLCGIASEVWRGVRLWLGAPNISMSNVEEMYQWVENSNGILAKRQIMLAICYMAIWVLWNYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G187590`
TK1151 ID	TkA08G187590
OH-1004 ID	LXL04_025559
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.400
Protein coverage (%)	TK1151 59.570 / OH-1004 10.997 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G187590

Location Chr08:48982039-48986609 (-)

Description Similar to LINE-1 reverse transcriptase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37510`	Binds specific group II introns in chloroplasts and facilitates their splicing.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0810100`	Binds specific group II introns in chloroplasts and facilitates their splicing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025559 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0003723 RNA binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.340

Rank 1 · TkA08G187590 · TK1151

Nucleus0.267

Rank 2 · TkA08G187590 · TK1151

Cell membrane0.182

Rank 3 · TkA08G187590 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA08G187590 · TK1151

Golgi apparatus0.092

Rank 5 · TkA08G187590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT144-208 aa

PF13966zf-RVT251-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G187590	`PF13966`	zf-RVT	144	208	5.2e-15	56.6
TkA08G187590	`PF13966`	zf-RVT	251	268	5.2e-15	56.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZV0`	Arabidopsis thaliana	sp\|Q9SZV0\|RNC1_ARATH Ribonuclease III domain-containing protein RNC1, chloroplastic	71.900%	Swiss-Prot	Low
`Q8S1Z0`	Oryza sativa subsp. japonica	sp\|Q8S1Z0\|RNC1_ORYSJ Ribonuclease III domain-containing protein RNC1, chloroplastic	80.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card