TkA08G185210 | RubberDandelionOmics

Gene overview

TkA08G185210

Reference: TK1151 Chr: Chr08 Coordinates: 48395767-48401194 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · TkA08G185210|TK1151|cDNA

TGTCACACAAATTTTGCAGCCATGGAAGCAGAACCAAAACCATCTGGTTCACCGACCAAAGGTGGCTGGATCACCTTCCCTTTCCTCATAGCAACCATGGCTGGGTTTGACATAGCCGCCGAGGATGGGCGAATAATATTATCGTATATCTACATCAACGAGTTCCACATCAAAAGCATCGATGCTGCTCAAATTGCAAACATAGTCAACGGGTGCAACGCACTGTTCCCAATCCTAGGAGCCATACTCGCTGACTCGTT...

CDS

Download CDS FASTA

1296 bp · TkA08G185210|TK1151|CDS

ATGGCCCCATCAAAAATTCAACTCGCAGTCCTGTACACGAGCCTGACGCTTTCAAGCGTCGGGCTCGCGGGTACACGGTTCACGTTAGCAACAATGGGAGCAGATCAATTCGATAAACCTAAGGATCAAGGGGTTTTCTTTAATGGCCACTTTTTTACTATGGATGCCGGGACACTTGTGAGTGTTGTGGGGATTATTTATGTTGAAGATAATGTGAGTTGGGGATTGGGGTTCGGTTTGTGTGTTGCGGCTAATTTGAT...

Protein

Download Protein FASTA

431 aa · TkA08G185210|TK1151|PROTEIN

MAPSKIQLAVLYTSLTLSSVGLAGTRFTLATMGADQFDKPKDQGVFFNGHFFTMDAGTLVSVVGIIYVEDNVSWGLGFGLCVAANLIGLVVFVVGRRKYRLLKPQGSPFTGLACVVVAAFRKRKVLLSLKGEDYWQEPLAGGTKLVRSTPTNSFKFLNHAALITQGDNTSNNSIKKPWNLCTLQQVEDLKTLIRISPLWSTGILLSTPLAIQMSLVVLQALSMDRHLGPTFQISAGTMMVFVMLSTSISLALIDRFLLPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G185210`
TK1151 ID	TkA08G185210
OH-1004 ID	LXL04_032535
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 77.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G185210

Location Chr08:48395767-48401194 (+)

Description Similar to NPF2.7: Protein NRT1/ PTR FAMILY 2.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45650`	Transporter involved in a passive nitrate efflux.	Nitrate efflux at the root plasma membrane: identification of an Arabidopsis excretion transporter.2007 · DOI: 10.1105/tpc.106.048173
`At3g45660`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45700`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45710`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45680`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032535 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0006857 oligopeptide transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:1902075 cellular response to salt Biological Process

GO:1902476 chloride transmembrane transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G45650

ath:AT3G45660

ath:AT3G45680

ath:AT3G45700

ath:AT3G45710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.777

Rank 1 · TkA08G185210 · TK1151

Endoplasmic reticulum0.078

Rank 2 · TkA08G185210 · TK1151

Lysosome / Vacuole0.074

Rank 3 · TkA08G185210 · TK1151

Cytoplasm0.066

Rank 4 · TkA08G185210 · TK1151

Mitochondrion0.027

Rank 5 · TkA08G185210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854PTR25-378 aa

PF07690MFS_110-261 aa

PF24380DUF753666-119 aa

PF29348AtMg0105088-113 aa

PF29348AtMg01050188-232 aa

PF24380DUF7536205-222 aa

PF07690MFS_1317-406 aa

PF24380DUF7536347-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G185210	`PF00854`	PTR2	5	378	1.3e-62	212.7
TkA08G185210	`PF07690`	MFS_1	10	261	4.4e-08	33.2
TkA08G185210	`PF24380`	DUF7536	66	119	5.4	7.8
TkA08G185210	`PF29348`	AtMg01050	88	113	0.22	12.6
TkA08G185210	`PF29348`	AtMg01050	188	232	0.22	12.6
TkA08G185210	`PF24380`	DUF7536	205	222	5.4	7.8
TkA08G185210	`PF07690`	MFS_1	317	406	4.4e-08	33.2
TkA08G185210	`PF24380`	DUF7536	347	372	5.4	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1E2`	Arabidopsis thaliana	sp\|Q9M1E2\|PTR37_ARATH Protein NRT1/ PTR FAMILY 2.7	52.800%	Swiss-Prot	High
`Q9M1E1`	Arabidopsis thaliana	sp\|Q9M1E1\|PTR38_ARATH Protein NRT1/ PTR FAMILY 2.6	52.400%	Swiss-Prot	High
`Q9M173`	Arabidopsis thaliana	sp\|Q9M173\|PTR41_ARATH Protein NRT1/ PTR FAMILY 2.4	51.500%	Swiss-Prot	High
`Q9M172`	Arabidopsis thaliana	sp\|Q9M172\|PTR42_ARATH Protein NRT1/ PTR FAMILY 2.5	51.200%	Swiss-Prot	High
`Q9M175`	Arabidopsis thaliana	sp\|Q9M175\|PTR39_ARATH Protein NRT1/ PTR FAMILY 2.3	49.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card