Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3630 bp · TkA08G184580|TK1151|cDNA
ATGGCTGAAATCGCTGTTACCGCCGTCGTCACTGTGCTGTGTGAGAAGCTGATCTCAGGTGACTTGATGAAGCTTGCTCGATCCGAAGGGATTGATTCTCAGCTGCAGAAATGGAAGAAAAACTTGCTGCTGATCCAAGCCTTGCTGGCCGATGCAAGCCAGAAGCATATCAAAGACAAAGCTGTTCAATTATGGGTGAATGATCTCGAGGAATTGGCTTACGACATAGACGATGTACTCGATGAAATGGCCACGGAAAC...
3630 bp · TkA08G184580|TK1151|CDS
ATGGCTGAAATCGCTGTTACCGCCGTCGTCACTGTGCTGTGTGAGAAGCTGATCTCAGGTGACTTGATGAAGCTTGCTCGATCCGAAGGGATTGATTCTCAGCTGCAGAAATGGAAGAAAAACTTGCTGCTGATCCAAGCCTTGCTGGCCGATGCAAGCCAGAAGCATATCAAAGACAAAGCTGTTCAATTATGGGTGAATGATCTCGAGGAATTGGCTTACGACATAGACGATGTACTCGATGAAATGGCCACGGAAAC...
Protein
Download Protein FASTA1209 aa · TkA08G184580|TK1151|PROTEIN
MAEIAVTAVVTVLCEKLISGDLMKLARSEGIDSQLQKWKKNLLLIQALLADASQKHIKDKAVQLWVNDLEELAYDIDDVLDEMATETIRRRLNQEASSSTSMITGKVLKFFPSCCTNLTPPKIMYGWKMSSELNKITTKLHDLVDQKNNLGLNVNVGMSNTRERRLEQTSLVDESKIMGREKDKDALLGKLLENDENVRIVSIIGMGGIGKTTIAKLLYNEEKVKGHFGVRAWVCVSEDLDVFNISKAIFQAVTGVNQDF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G184580 |
|---|---|
| TK1151 ID | TkA08G184580 |
| OH-1004 ID | LXL04_016183 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 89.500 |
| Protein coverage (%) | TK1151 99.669 / OH-1004 89.415Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G184580 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:48198632-48202261 (+) | |||||||||
| Description | Similar to RPPL1: Putative disease resistance RPP13-like protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0051607 defense response to virus Biological Process GO:0098542 defense response to other organism Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0004016 adenylate cyclase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G14460 ath:AT3G14470 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF18052Rx_N6-94 aaPF00931NB-ARC76-104 aaPF13191AAA_16178-298 aaPF00931NB-ARC180-348 aaPF20720nSTAND3197-250 aaPF13401AAA_22199-286 aaPF13173AAA_14199-288 aaPF00005ABC_tran199-227 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G184580 | PF18052 | Rx_N | 6 | 94 | 2.4e-19 | 69.9 |
| TkA08G184580 | PF00931 | NB-ARC | 76 | 104 | 3.7e-37 | 128.3 |
| TkA08G184580 | PF13191 | AAA_16 | 178 | 298 | 0.00012 | 23.3 |
| TkA08G184580 | PF00931 | NB-ARC | 180 | 348 | 3.7e-37 | 128.3 |
| TkA08G184580 | PF20720 | nSTAND3 | 197 | 250 | 0.0099 | 16.3 |
| TkA08G184580 | PF13401 | AAA_22 | 199 | 286 | 0.015 | 16.3 |
| TkA08G184580 | PF13173 | AAA_14 | 199 | 288 | 0.086 | 13.6 |
| TkA08G184580 | PF00005 | ABC_tran | 199 | 227 | 0.087 | 14.1 |
| TkA08G184580 | PF13238 | AAA_18 | 203 | 290 | 0.24 | 12.6 |
| TkA08G184580 | PF23247 | LRR_RPS2 | 280 | 292 | 1.4e-14 | 55.1 |
| TkA08G184580 | PF23559 | WHD_DRP | 434 | 497 | 2.2e-23 | 82.8 |
| TkA08G184580 | PF13401 | AAA_22 | 485 | 507 | 0.015 | 16.3 |
| TkA08G184580 | PF23247 | LRR_RPS2 | 521 | 544 | 1.4e-14 | 55.1 |
| TkA08G184580 | PF23598 | LRR_14 | 564 | 844 | 4.6e-33 | 115.2 |
| TkA08G184580 | PF23247 | LRR_RPS2 | 571 | 609 | 1.4e-14 | 55.1 |
| TkA08G184580 | PF25019 | LRR_R13L1-DRL21 | 572 | 632 | 1.3e-39 | 135.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.